KEGG   Rhodomicrobium vannielii: Rvan_1229Help
Entry
Rvan_1229         CDS       T01353                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rva  Rhodomicrobium vannielii
Brite
Enzymes [BR:rva01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Rvan_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1365465..1366670)
Genome map
AA seq 401 aa AA seqDB search
MKHMLFSRRLFFGVAAAAVAVSFLIHTHEQDHKAEVVRTEAARFAALKAEAEQLVADFPA
DPDAQALGRVRMAYERARAAWPAPILLPDAKVAEFAPLEIRPKPSGIAIAKVELGRMLFE
DPRLSVSGQIACQNCHNQELGWGDGLRSSFGHNRKRGKRNAPPLFSAAYRPALFWDGRVT
KLEEQALGPMTNPIEMAVHDFSAVTARLGKDDIYRERFRSIYGSDQIDIAWVADAVAAFE
TTLERPTRFDRFLKSDTAALTDEQVWGMHLFRTKAGCMNCHSGPLLTDERYHNLGLSLLG
RPLGDLGRQAVTGLEDDVGRFRTASLRHVSKTGPYMHNGLIPDLRRVVIFYEIGGGKTRP
INDKQTTDDLMRAAAKTSPLVKKFNFTPAERQALIEFLKAL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacatgctcttttcccgacgtctcttcttcggcgtggcggccgctgcggtcgcc
gtgtcgttcctcatccacacccatgaacaagaccacaaggctgaggtcgtccgcacggaa
gcggcgcgatttgcggcgctgaaggcagaggccgagcaactggtagcggattttccggcc
gatcccgacgctcaagcgctcggtcgcgttcgcatggcttacgaaagggcacgggccgcc
tggcccgcgcccatcttgcttccagacgccaaagtcgccgaattcgcgccgctcgaaatc
cggccgaagccaagcggtatcgcaatcgcgaaggtcgagcttggccgaatgctgttcgaa
gacccgcgcctgtccgtctccgggcagatcgcctgtcagaattgccataaccaggaactc
ggctggggcgatggtttgcgttcctctttcggccacaaccgcaagcgtggcaagcgcaat
gcgccgccgctgttcagtgccgcctatcgtccggctcttttctgggatggtcgcgttacc
aagcttgaggagcaggcgctcgggcccatgacgaatccgatcgagatggcggttcacgat
ttcagcgcagtgaccgcgcgtctcggaaaggacgatatctatcgagagcgcttccgcagc
atttatggttcggatcagatcgatatcgcatgggtagcagacgccgtcgccgccttcgaa
acgactcttgagcgcccgacgcgcttcgatcgcttcctcaagagcgatacggcagcgcta
accgatgaacaagtgtggggtatgcatcttttccgcacgaaagccggttgcatgaactgc
cacagcggcccgcttctcaccgacgagcgctatcacaatctcggtctttccctgctcggc
agaccgctgggcgacctcggccgtcaagcagtgacagggcttgaggacgatgttggccgg
ttccgcacagccagcctgcggcatgtctcgaagacggggccttacatgcacaacggattg
atcccggatcttcggcgcgtcgtcatcttctacgagattggaggcggcaagacgcgtccc
atcaacgacaaacaaaccacggacgatctcatgcgcgctgccgcgaagacctcgccgctc
gttaaaaaattcaacttcacgccagcagagcgccaggcactcatcgaattcctcaaagcg
ctttag

DBGET integrated database retrieval system