KEGG   Rhodomicrobium vannielii: Rvan_1313Help
Entry
Rvan_1313         CDS       T01353                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rva  Rhodomicrobium vannielii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rvan_1313
   00052 Galactose metabolism
    Rvan_1313
   00500 Starch and sucrose metabolism
    Rvan_1313
   00520 Amino sugar and nucleotide sugar metabolism
    Rvan_1313
Enzymes [BR:rva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rvan_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1452447..1453373)
Genome map
AA seq 308 aa AA seqDB search
MSKPIRKAIFPVAGLGTRFLPANKAMPKEMLTVVDRPIIQHVADEARTGGIEHFIFVTGR
NKGVIEDHFDRQFELEEVLRRRNKQEELLNLETHLPKPGATSFTRQQEPLGLGHAVWCAH
DIVGSDPFALLLPDVIVLPDGESCLGQMIRVYGNLTEKYPDAKINIVAVEEVAPEETSSY
GVVGLAGVEGDSLWRIDSMVEKPAKGTSPSNLIIMGRYILQPEIFDILKYQERGAGNEIQ
LTDAMRTLMRDQLFFAYKFRGKSYDCGSKLGFLTANVAFALARSDLGPKFGEELKKLAAE
MQVKKAAE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcctatccgcaaggccattttccccgtcgccggtctcggcacgcgctttctc
cccgccaacaaggcgatgccgaaagagatgctgaccgttgtcgatcgccccatcatccag
cacgtggccgacgaggcgcgtactggcggcatcgagcatttcatcttcgtaactgggcgc
aataaaggcgtcatcgaggatcatttcgaccggcaattcgagctggaagaagtgcttagg
cggcgcaacaagcaggaagagctgctcaacctcgaaacgcatctgccgaagccgggtgcg
acgagcttcacgcgtcagcaggagccgctcggcctcggtcacgcggtgtggtgcgcgcac
gacatcgtgggcagcgatccgttcgcgctgctgctgccggacgtgatcgtgctgcccgat
ggcgagagctgcctcggccagatgatccgtgtctatggcaatctcaccgagaaatatccc
gacgcgaagatcaacatcgtcgccgtcgaagaggtcgcgcccgaggagacgagttcctac
ggcgtggtcggacttgctggcgtcgagggcgacagcttgtggcgtatcgattcgatggtg
gaaaagccggccaagggcacctcgccctcgaatctcatcatcatgggtcgctatatcctc
cagcccgagattttcgacatcctgaagtatcaggagcgcggcgcgggcaacgagatccag
ctgaccgacgcgatgcgcacgctcatgcgcgatcaactgttcttcgcctacaaatttcgg
ggcaagagctacgattgcggctcgaagcttggcttcctcacggcgaacgtcgcgttcgcg
ctggcgcgctccgacctcggccccaaatttggcgaggagctgaagaagctcgccgccgag
atgcaggtgaaaaaggccgccgaataa

DBGET integrated database retrieval system