KEGG   Rhodomicrobium vannielii: Rvan_1563Help
Entry
Rvan_1563         CDS       T01353                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rva00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rva00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rva02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1705588..1707096)
Genome map
AA seq 502 aa AA seqDB search
MTSRTLAVALGLAGVAALCAPAQAQGIKQAQDSYFLAAKADLEKILARQPNTKKAKNIIL
FIGDGMSIPTVTAARIMDGQRRGVDGESNSLAFETLLPYVALSKTYTHDSQVADSAPTAT
ALVSGVKSVNGTIGVDQHVTVGNCASQKGTEVTTIFELAEKAGLSTGIVSTARITHATPA
AAYAKTAGRDWEVDTNLPGPAKAAGCKDIATQLVEWPAGNGFEVILGGGRSYFLPKEVAD
PETEGKTGTRADGRNLVDEWQRKYNDAAYVWNKEQFDAIDPAKTGHVLGLFERSHMQYEA
ERAKDKAGEPSLAEMTTKAIDFLSKNKDGFVLMVEGGRIDHAHHDGKAGLALLDTLALDE
AVKAAYAKVDPEETLIILTADHSHVFSISGYPKRGNPILGLAGYGLDGKPYTTLGYLNGP
GAKANEARADLNGVDTTALDFRQQALIPLDAESHAGDDVAVFAQGPSAHLFQGVIEQNMI
FHVMTHASGILEKVGRDTAAAK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgaaccctcgcggtggccttgggactcgcgggcgtggcagcgctatgcgca
cccgcccaggcgcagggcatcaagcaggcgcaggacagctatttccttgcggcgaaggct
gatctcgaaaaaatcctcgcacgccagccgaatacgaagaaggcgaagaacatcatcctg
ttcatcggcgacggcatgtcgattccgacggtgacggccgcccgcatcatggacgggcag
cggcgcggcgtggatggcgaaagcaactcgctcgcgttcgagacccttcttccctatgtg
gcgctgtcgaagacttatacgcatgacagccaggtggcggattccgcgccgactgcgacc
gcgttggtgtccggcgtaaagtcggtcaatggcaccatcggcgtcgatcagcacgtgacg
gttggcaattgcgcgagccagaagggcaccgaggtcacgacgatcttcgaactggccgaa
aaggccgggctttcgaccggcatcgtttcgacggcgcgcatcacgcatgcgacgcccgcg
gcagcatacgccaagacggcgggccgcgactgggaagtcgatacgaaccttcccggcccc
gcgaaagcggcgggctgcaaggacatcgccacgcaactcgtcgaatggcccgcaggcaac
ggcttcgaggtgattctcggcggcggccgatcgtatttcctgccgaaggaagtcgccgac
cctgaaaccgaaggcaagacgggcacgcgcgccgatggccgcaatctcgtcgatgagtgg
cagcgcaaatacaacgacgcggcctatgtctggaacaaggagcagttcgacgcaatcgat
ccggccaaaaccggccatgtgctcggccttttcgagcgcagccacatgcaatacgaggcg
gaacgcgcgaaggacaaggcgggcgagccctcactcgcggagatgaccaccaaggccatc
gactttctgtcgaagaacaaggatggcttcgtgctgatggtggagggtggccgcatcgac
cacgctcatcacgacggcaaggccggtctcgcgctcctcgatacgctggcgctcgacgag
gcggtgaaggccgcttacgccaaggtcgatcccgaggaaacgctgattatcctgacggcg
gaccacagccacgtcttctccatctcgggctatccgaagcgcggcaacccgatcctcggc
ctcgcgggctacggcctcgacggcaagccctacaccacgctcggctatctgaacgggccg
ggcgccaaggcgaacgaggcgcgcgccgatctcaacggcgtggataccaccgccctcgac
ttccgccagcaggcgctgatcccgctcgacgcggaatcgcacgcgggcgacgacgtggcc
gtcttcgcgcaggggccctcggcgcacctgtttcagggcgtcatcgagcagaacatgatc
ttccatgtcatgacgcatgcgtcgggcattctggagaaggtgggccgggatacggccgcc
gcgaagtaa

DBGET integrated database retrieval system