KEGG   Rhodomicrobium vannielii: Rvan_1667Help
Entry
Rvan_1667         CDS       T01353                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00010  Glycolysis / Gluconeogenesis
rva00620  Pyruvate metabolism
rva00640  Propanoate metabolism
rva00680  Methane metabolism
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rvan_1667
   00620 Pyruvate metabolism
    Rvan_1667
   00640 Propanoate metabolism
    Rvan_1667
  Energy metabolism
   00680 Methane metabolism
    Rvan_1667
Enzymes [BR:rva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rvan_1667
Lipid biosynthesis proteins [BR:rva01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rvan_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADP70917
JGI: Rvan_1667
UniProt: E3I8K8
Position
1820458..1822404
Genome map
AA seq 648 aa AA seqDB search
MTGKIYPVSEAWSSSAYIDENKYRALYEQSVSDPEGFWGEQAARIDWIKPFTKVKNTSYD
PHNVSIKWYEDGSLNVAANCIDRHLETRGDQIAIIWEGDEPNLDLKVTYRELHDRVSRFA
NVLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAIHSVVFGGFSPDSLASRIVDCDSS
VVITADEGVRGGRKVPLKANADKALEKCPSVERVLVVKRTNGTVGWTPGRDYWLAEEMES
VSADCPPEEINAEDPLFILYTSGSTGQPKGVLHTSGGYLVYASLTHQYIFDYKDGDIYWC
TADVGWVTGHSYILYGPLANGATTVMFEGVPNYPTASRFWDVIDKHQVNTFYTAPTAIRA
LMGAGDELVKKTSRKSLKLLGSVGEPINPEAWEWYYHVVGEERCPIVDTWWQTETGGILI
SALPGAIALKPGSATLPFFGIKPALVTPDGQPIEGAGEGNLVITDSWPGQMRSVYKDHTR
FVQTYFSAYPGTYFTGDGCRRDEDGYYWITGRVDDVINVAGHRMGTAEVESALVAHPKVA
EAACVGYPHSLKGQGIYVYVTLMEGIEPTEALRTELRNWVRQEIGPIATPDLIQFAPGLP
KTRSGKIMRRILRKIAEDDFSNLGDTSTLAEPGVVSDLIENRMNKAVA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaaaatttatccagtctccgaggcctggagcagctcggcctacatcgatgaa
aacaagtatcgcgcgctctacgagcagagcgtcagcgatcccgaaggtttctggggtgaa
caggccgcccgcatcgactggatcaaaccgtttacaaaggtcaagaacacttcatacgat
cctcataacgtctcgatcaagtggtacgaagacggctcgctgaatgttgccgcgaactgc
atcgaccgccatctcgaaactcgtggcgaccagattgccatcatttgggaaggcgacgag
ccgaatctggatctcaaggtcacgtatcgagaactacatgaccgcgtcagccgcttcgcg
aacgtgctcaagaagcacggcgtcaagaagggcgatcgcgtcacgatctaccttccgatg
atccccgaggccgcctatgcgatgctcgcttgcgcgcgcatcggagcaatccattcagtc
gttttcggcgggttctcgccggacagcctcgcgagccgcattgtcgactgcgactcgagc
gtcgtcatcacggccgacgagggcgtgcgcggtggccgcaaggttccgctcaaggcgaac
gccgacaaagcgcttgaaaagtgcccaagcgtggaacgcgtgctcgtggtgaaacgcacc
aatggcacggtcggctggacacccggccgggattactggcttgcggaagaaatggagtcc
gtctctgcagattgcccgccggaggagatcaacgcggaagacccgctgttcattctctat
acgtcgggctcgacgggccagccgaagggcgtgcttcacacatccggcggatatctggtt
tatgcttctctgacgcaccaatacatcttcgattacaaggatggcgatatctattggtgc
acggcagacgtcggctgggtcaccggccacagctacatcctctacggcccgctcgccaac
ggcgcgacgacggtcatgttcgagggcgtgccaaactatcccacggcatcgcgcttctgg
gatgtcatcgacaagcatcaggtgaacacgttctacacagcgccaaccgcgattcgcgcg
ctgatgggcgccggggacgaactcgtcaagaaaacgagccgcaagtcattgaaactgctt
ggtagcgtcggtgagccgatcaatcccgaagcttgggaatggtattaccacgtcgtcggc
gaggaacgttgccccatcgtcgacacctggtggcagactgaaaccggcggcattctcatc
agcgctctgcccggtgctatcgcccttaagcccggctcggccacgctgccgttcttcggc
ataaagcccgcactcgtgacgcctgatgggcagccgatcgagggcgctggagagggcaac
ctcgtcatcaccgattcatggcccggccagatgcgctccgtctacaaggatcacacgcgt
ttcgtccaaacctacttctcggcctacccgggcacctatttcacgggcgatggctgccgc
cgcgatgaggacggctactactggatcaccggccgcgtcgacgacgtgatcaacgtggcg
gggcaccgcatggggacggccgaggtcgagtcggcgctcgtggctcacccgaaggtggcg
gaagcggcctgcgtcggctatccgcacagcctgaaaggtcagggtatctatgtctacgtc
accctgatggaaggcatcgagccgaccgaggcgctccgcaccgaattgcgcaattgggtg
cggcaggaaatcgggccgatcgcgacgccggacctcatccagttcgcgcccggcctgccg
aaaacgcgctccggcaagatcatgcgtcgcatcctgcgcaagatcgcggaggacgacttt
tcgaacctcggcgatacgtccacgctggcggaaccgggcgtggtgtcggatctgatcgag
aatcgcatgaacaaggcagtcgcctga

DBGET integrated database retrieval system