KEGG   Rhodomicrobium vannielii: Rvan_1667Help
Entry
Rvan_1667         CDS       T01353                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rvan_1667
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rvan_1667
   00620 Pyruvate metabolism
    Rvan_1667
   00640 Propanoate metabolism
    Rvan_1667
  Energy metabolism
   00680 Methane metabolism
    Rvan_1667
Enzymes [BR:rva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rvan_1667
Lipid biosynthesis proteins [BR:rva01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rvan_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1820458..1822404
Genome map
AA seq 648 aa AA seqDB search
MTGKIYPVSEAWSSSAYIDENKYRALYEQSVSDPEGFWGEQAARIDWIKPFTKVKNTSYD
PHNVSIKWYEDGSLNVAANCIDRHLETRGDQIAIIWEGDEPNLDLKVTYRELHDRVSRFA
NVLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAIHSVVFGGFSPDSLASRIVDCDSS
VVITADEGVRGGRKVPLKANADKALEKCPSVERVLVVKRTNGTVGWTPGRDYWLAEEMES
VSADCPPEEINAEDPLFILYTSGSTGQPKGVLHTSGGYLVYASLTHQYIFDYKDGDIYWC
TADVGWVTGHSYILYGPLANGATTVMFEGVPNYPTASRFWDVIDKHQVNTFYTAPTAIRA
LMGAGDELVKKTSRKSLKLLGSVGEPINPEAWEWYYHVVGEERCPIVDTWWQTETGGILI
SALPGAIALKPGSATLPFFGIKPALVTPDGQPIEGAGEGNLVITDSWPGQMRSVYKDHTR
FVQTYFSAYPGTYFTGDGCRRDEDGYYWITGRVDDVINVAGHRMGTAEVESALVAHPKVA
EAACVGYPHSLKGQGIYVYVTLMEGIEPTEALRTELRNWVRQEIGPIATPDLIQFAPGLP
KTRSGKIMRRILRKIAEDDFSNLGDTSTLAEPGVVSDLIENRMNKAVA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaaaatttatccagtctccgaggcctggagcagctcggcctacatcgatgaa
aacaagtatcgcgcgctctacgagcagagcgtcagcgatcccgaaggtttctggggtgaa
caggccgcccgcatcgactggatcaaaccgtttacaaaggtcaagaacacttcatacgat
cctcataacgtctcgatcaagtggtacgaagacggctcgctgaatgttgccgcgaactgc
atcgaccgccatctcgaaactcgtggcgaccagattgccatcatttgggaaggcgacgag
ccgaatctggatctcaaggtcacgtatcgagaactacatgaccgcgtcagccgcttcgcg
aacgtgctcaagaagcacggcgtcaagaagggcgatcgcgtcacgatctaccttccgatg
atccccgaggccgcctatgcgatgctcgcttgcgcgcgcatcggagcaatccattcagtc
gttttcggcgggttctcgccggacagcctcgcgagccgcattgtcgactgcgactcgagc
gtcgtcatcacggccgacgagggcgtgcgcggtggccgcaaggttccgctcaaggcgaac
gccgacaaagcgcttgaaaagtgcccaagcgtggaacgcgtgctcgtggtgaaacgcacc
aatggcacggtcggctggacacccggccgggattactggcttgcggaagaaatggagtcc
gtctctgcagattgcccgccggaggagatcaacgcggaagacccgctgttcattctctat
acgtcgggctcgacgggccagccgaagggcgtgcttcacacatccggcggatatctggtt
tatgcttctctgacgcaccaatacatcttcgattacaaggatggcgatatctattggtgc
acggcagacgtcggctgggtcaccggccacagctacatcctctacggcccgctcgccaac
ggcgcgacgacggtcatgttcgagggcgtgccaaactatcccacggcatcgcgcttctgg
gatgtcatcgacaagcatcaggtgaacacgttctacacagcgccaaccgcgattcgcgcg
ctgatgggcgccggggacgaactcgtcaagaaaacgagccgcaagtcattgaaactgctt
ggtagcgtcggtgagccgatcaatcccgaagcttgggaatggtattaccacgtcgtcggc
gaggaacgttgccccatcgtcgacacctggtggcagactgaaaccggcggcattctcatc
agcgctctgcccggtgctatcgcccttaagcccggctcggccacgctgccgttcttcggc
ataaagcccgcactcgtgacgcctgatgggcagccgatcgagggcgctggagagggcaac
ctcgtcatcaccgattcatggcccggccagatgcgctccgtctacaaggatcacacgcgt
ttcgtccaaacctacttctcggcctacccgggcacctatttcacgggcgatggctgccgc
cgcgatgaggacggctactactggatcaccggccgcgtcgacgacgtgatcaacgtggcg
gggcaccgcatggggacggccgaggtcgagtcggcgctcgtggctcacccgaaggtggcg
gaagcggcctgcgtcggctatccgcacagcctgaaaggtcagggtatctatgtctacgtc
accctgatggaaggcatcgagccgaccgaggcgctccgcaccgaattgcgcaattgggtg
cggcaggaaatcgggccgatcgcgacgccggacctcatccagttcgcgcccggcctgccg
aaaacgcgctccggcaagatcatgcgtcgcatcctgcgcaagatcgcggaggacgacttt
tcgaacctcggcgatacgtccacgctggcggaaccgggcgtggtgtcggatctgatcgag
aatcgcatgaacaaggcagtcgcctga

DBGET integrated database retrieval system