KEGG   Rhodomicrobium vannielii: Rvan_1741Help
Entry
Rvan_1741         CDS       T01353                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rvan_1741
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rvan_1741
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rvan_1741
Enzymes [BR:rva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rvan_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1906951..1908348
Genome map
AA seq 465 aa AA seqDB search
MMYVSTRGAAPKADFEEALLAGLAPDGGLYMPETWPQLSSLPASPTGAYAAAAAHVMTPY
MGGNPGEAELFALVSDAYERFADPDTAPLKTIGLDLYLLELFHGPTLAFKDFAMQVLSRL
MERALKRRGQRTTIVGATSGDTGAAAVEAFRGRDDIELFILYPHGRISDVQRKQMTTATE
DNIHAIAIEGTFDDTQAIVKALFGDAEFRTRHALSAINSINWARIVAQTVYYYTAAAKLG
TACHPSFSVPTGNFGDIFAGFASSLMGLSMGRLVIATNENDILARTLETGRYEPKGVVPT
DSPSMDIQISSNFERLLFEESGRDADLVNRAMADLKAKGHFDLPPATLARIRERFTAWRV
TRDEAADATRALFNETGMIIDPHTAVGVVAGKREQERSGGSMVVLSTAHPAKFPEAVTRA
TGRAADIPERLVERLQGRERLQILPNSAAAVADVIARHAANRPQA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacgtctcgacacgaggggccgcgccgaaagcggacttcgaggaagcgcttctc
gccggtctcgcgcccgatggcgggctttacatgccggaaacctggccgcagctatcgtcc
ttgccggcatcgcccacaggcgcctacgcggcggcggcggcgcatgtgatgacgccatac
atgggcggcaaccccggcgaggcggagcttttcgcgcttgtgtcggatgcctacgagcgc
ttcgccgatcccgataccgcgccgctcaagacaatcgggctggatctctatctgcttgag
ctgttccacggaccgacgctcgccttcaaggacttcgcgatgcaggttctgtcgcggctg
atggagcgcgcgctgaagcggcgcggtcagcgcacgacgattgtcggcgcgacatcgggc
gatacgggcgcggcggcggtcgaggcgtttcgtggccgcgacgacatcgagctgttcatt
ctttatccgcatggccgcatctcggacgtgcagcgcaagcagatgacgacggcgaccgag
gacaacatccacgccatcgccatcgagggcacgttcgacgatacgcaggccatagtgaag
gcgctctttggcgacgcggaattccgcacgcgacacgcgctttcggcgatcaattccatc
aactgggcgcgcatcgtggcccagacggtctattactatacggcggcggcgaagctcggc
acggcgtgtcacccgagcttctcggtgcccaccggcaatttcggcgacatcttcgcgggc
ttcgcgtcgtcgctgatgggcctgtccatgggccgcctcgtcatcgcgacgaacgagaac
gacatcctcgctcgcacacttgagacgggccgctacgagcccaagggcgtcgtgccgacc
gacagcccgagcatggacatccagatttcgagcaatttcgagcggcttctgttcgaggag
agcggccgcgatgccgacctcgtgaaccgcgcgatggccgatttgaaggcgaaaggtcac
ttcgacctgccgcccgctacgctcgcccgcatccgcgagcgcttcacggcgtggcgcgtg
acgcgcgatgaggccgcggacgcgacccgcgcgctgttcaatgaaaccggcatgattatc
gatccgcataccgccgtcggcgttgttgcgggcaagcgcgagcaggagcgcagcggcggt
tcgatggtggtgctttcgacggcgcatcccgcaaagttcccggaggccgtaacgcgcgcg
acaggccgcgcggccgatattcccgaacgcctcgtggagcgccttcagggtcgcgagcgt
ttacagattttgccgaactcggccgctgcggtagcggacgtgatcgcccggcacgcagca
aacaggccgcaagcatga

DBGET integrated database retrieval system