KEGG   Rhodomicrobium vannielii: Rvan_1914Help
Entry
Rvan_1914         CDS       T01353                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rva  Rhodomicrobium vannielii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rva01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rva00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rva00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2095847..2097457
Genome map
AA seq 536 aa AA seqDB search
MSTAPILHLAIPDGMKITGPIEPGYDRVLTGPALEFIGELHRRFEPRRRELMEARGVRQA
AWDSGALPDFLPETKKIREVDWTIAGIPDDLTDRRVEITGPTTRKMIINALNSGAKVFMA
DCEDSLSPTWANVVEGQINLADYWRGNIDFTEEDTGKSYAVGPNPAVLMVRPRGWHLVER
HVTVDKQPVAGALFDFGLYFFHNAQAALAKGSGPYFYLPKMESHLEARLWNEVFLFAEEH
LQLRTGTIKSTVLIETLPAVFEMHEILYELRDHIVGLNCGRWDYIFSYIKTLRTKPDRIL
PDRGQVVMSKAFLKAYAELLIQTCHRRGAFAMGGMSAFIPNRRDPEVNDKALAAVREDKL
REVTYGHDGTWVAHPDLVPVALAVFDEHMPKKNQLSKLREDVAVGQRELLQPHDGTRTEE
GLRVNTRVGIQYIEAWLRGNGAVPLYNLMEDAATAEISRTQNWQWLHHGATLEDGRKVTP
ELIEAIISDEMLKLHEKLGAYYESGRFPEAIALFRDLVMSGELNAFLTLPAYKLIE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgccccgatcctgcacctggccattcccgacggcatgaagatcacgggtccg
atcgaacctggctatgaccgggtgctgaccggccccgcgctcgaattcatcggcgagttg
catcgccgcttcgagcctcggcggcgcgagcttatggaggcgcgcggcgtacgtcaggcg
gcgtgggacagcggcgcgttgcctgattttctgccggagacgaagaagatccgcgaggtg
gactggaccatcgcgggcatcccggacgacctgaccgaccggcgcgtggaaatcaccggg
ccgacgacgcgcaagatgatcatcaacgcgctgaactcgggcgcgaaggtgttcatggcc
gattgcgaagactcgttgtcgccgacctgggcgaacgtcgtcgaaggccagatcaacctc
gccgattactggcgcggcaacatcgatttcaccgaggaagacaccggcaaatcctatgca
gtggggccgaaccctgccgtgctgatggtgcgcccgcgcggctggcacctcgtcgagcgt
catgtgacggtggacaagcaaccggttgcgggcgcgcttttcgacttcggcctctatttc
tttcacaacgcgcaagccgcgctggcgaagggcagcggcccttacttctacctcccgaag
atggagagccacctcgaagcgcgcctctggaacgaggtgttcctgttcgccgaggagcac
ctgcaactccgcaccggcaccatcaaatcaacggttctgatcgagacgttaccggccgtc
ttcgaaatgcacgaaattctctacgagcttcgtgaccatatcgtcggcctcaattgcggt
cgctgggactacatcttttcatacatcaagacgctgcgcacgaagccagatcgcatcctg
cccgaccgcggtcaggtggtgatgagcaaggcattcctcaaagcctatgccgagctgctg
atccagacatgtcaccggcgcggcgcattcgccatgggcggcatgtcggcgttcatcccg
aaccgccgcgaccccgaagtgaacgacaaggcgcttgccgccgttcgcgaggacaaacta
cgcgaggtcacctacggccatgacggcacgtgggtggcgcatcccgatctcgtgccggtc
gcgctcgccgtatttgacgagcacatgccgaaaaagaaccagctttcgaagctgcgcgaa
gatgtcgcagtgggacagagggagctgctccagccccacgacggcacgcgcaccgaggag
gggcttcgcgtcaacacgcgcgtcggcattcaatatatcgaggcatggctgcgcgggaat
ggcgcggtgcctttgtataatctgatggaagacgcagcgacggccgagatttcgcgcacg
cagaattggcaatggctgcatcatggcgcgacgctggaagatggccgcaaggtcacgccc
gagctgatcgaagcgatcatctccgatgagatgctgaagcttcacgaaaagcttggcgcg
tactacgagagcgggcgtttcccggaagcgatcgccttgtttcgcgacctcgtcatgagc
ggggaactcaatgcgttcctgacgcttcctgcttacaaactgatcgaatga

DBGET integrated database retrieval system