KEGG   Rhodomicrobium vannielii: Rvan_2001Help
Entry
Rvan_2001         CDS       T01353                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rva  Rhodomicrobium vannielii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rva00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2184035..2185285
Genome map
AA seq 416 aa AA seqDB search
MTKNGQAHELNGAGYRKRVSVLGATGTIGDSTCDLLAQNPDRFEVVALSANRNAKKLASL
AVQFKAKFAAVADESAGAELRDLLAGTGIECGAGKSAVVDAGARDADVVMASIVGYAGLA
PTLAALKQGRTVALANKECLVCAGAYFMNERERYGTTLLPVDSEHSAVFQSLEQEGRYVE
KIVLTASGGPFRTWTKEQIAAARVEDALKHPNWTMGQKITIDSATLMNKGLEIIEAFHLF
KVRADQLDAVVHPQSIIHALVYYTDGSVIAQASVPDMRTPIALSLAWPERLKAETIKRLD
LAEAATLTFEKPDETRFPALRLAKEVLKSGGNTPTVLNAANEVAVEAFLNRQISFPGIAE
AVERTLDMATSALAGVLPDSLDAVTHIDERARDIAKSALSSARPAVTIAEAAAPRI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaacgggcaggcacacgaattgaatggggcgggttaccgaaagcgcgtaagc
gtgctgggtgcgaccggcaccatcggcgacagcacctgcgatctcctcgcacaaaacccc
gaccggttcgaggtcgtggcgctgtcggcgaaccgcaacgcgaaaaagctcgcgagcctt
gccgtgcagttcaaggcgaaattcgcggcagtcgccgacgaaagcgcgggcgctgaactg
cgcgacctgctcgccgggacggggatcgaatgcggcgcgggcaagtcggcggtggtcgat
gccggtgctcgcgatgccgatgtcgtgatggcgtccatcgtcggctatgcgggcctggcg
cccacgctggcggctctgaagcagggccggacggtggcgctcgccaataaggaatgtctc
gtctgcgccggcgcttatttcatgaacgagcgcgagcgctacggcacgacgctgctgccg
gtcgattcggaacattcggccgtgtttcagtcgcttgagcaggaagggcgctacgtcgag
aagatcgtgctcaccgcttcgggtggtccgttccgcacatggacgaaggagcagatcgcg
gcggcgcgcgtcgaggatgcgttgaagcatccgaattggacgatggggcagaaaattacc
atcgacagcgccacgctcatgaacaagggcctcgaaatcatcgaggcgttccacctcttc
aaggtgcgcgccgaccaactcgatgccgtggtgcatccgcagtcgatcatccacgcgctc
gtctattacaccgacggctcggtgatcgcgcaggcgagcgtgcccgatatgcgcacgccc
atcgcgctgagccttgcctggccggagcggctcaaggcggaaaccatcaagcggctcgac
cttgccgaggctgccacgctcaccttcgagaagcccgacgagacgcgcttccccgcgctc
cgcctcgcaaaggaagtgctgaagtccggaggcaacacgccgaccgtgctcaacgcggcg
aacgaggtggcggtggaagccttcctgaatcgccagatttccttccccggcatcgccgag
gcagtcgaacgcacgctcgacatggcgacgtccgcgctcgccggcgtgctgccggatagt
ctcgacgccgtcacccatatcgacgagcgcgcccgtgatatcgccaaatcggcgctcagc
tccgctcgtcccgccgtcacgatcgcggaagcggcggctccgcgtatttaa

DBGET integrated database retrieval system