KEGG   Rhodomicrobium vannielii: Rvan_2205Help
Entry
Rvan_2205         CDS       T01353                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rva  Rhodomicrobium vannielii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rvan_2205
Enzymes [BR:rva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rvan_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2420261..2420911)
Genome map
AA seq 216 aa AA seqDB search
MARYMSANQGILLQNGIFIALGSNLPGPWGSPEETLQRAVRELASCGVEIEKTSRLYRTK
AHSEVEQPDFVNAVASVNSSMPADALLRVLKRIEAQAGRFLTVKHHHADHRWAPRPLDLD
IVSYKSLVRNWLRGHPVRDAKLTLPHPRAHERAFVLRPLMDVAPRWHHPVLGLTAAALLA
RPTVRDTGAILDVDGLLVEMNSRRYSKDITSPRTEA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctcgatatatgagtgcaaatcaaggcattttgttgcaaaacgggattttcattgca
ctcgggtccaacctgcctgggccttggggatcgcccgaggagactctccagagggcggtc
cgggaactggcttcatgcggcgtcgaaatcgaaaaaacgtcgagactctatcggacgaag
gcgcatagcgaggtagaacagcccgactttgtaaatgccgtcgcatccgtcaactcgtca
atgcctgcggacgcactgttacgagttttgaagcggattgaggcgcaagcggggcgattt
ctcaccgtcaagcatcatcacgccgatcaccgatgggctccgcgcccactcgatctcgac
atcgtaagctataagagcctcgtgcgcaactggctgcggggccaccctgtaagggatgcg
aagctcacccttccccatccgcgcgctcatgaacgagcgttcgtcctccgccctctcatg
gacgttgcgccgcgctggcaccacccggtgctcgggcttacggcggcggcgttgctcgcg
cgcccgaccgttcgcgacaccggcgcgatccttgacgtcgacgggcttctcgtggagatg
aatagtcgtcgctactccaaggacataacatcgcctcgaactgaagcttaa

DBGET integrated database retrieval system