KEGG   Rhodomicrobium vannielii: Rvan_2233Help
Entry
Rvan_2233         CDS       T01353                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00071  Fatty acid degradation
rva00280  Valine, leucine and isoleucine degradation
rva00281  Geraniol degradation
rva00310  Lysine degradation
rva00360  Phenylalanine metabolism
rva00362  Benzoate degradation
rva00380  Tryptophan metabolism
rva00410  beta-Alanine metabolism
rva00627  Aminobenzoate degradation
rva00640  Propanoate metabolism
rva00650  Butanoate metabolism
rva00903  Limonene and pinene degradation
rva00930  Caprolactam degradation
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rvan_2233
   00650 Butanoate metabolism
    Rvan_2233
  Lipid metabolism
   00071 Fatty acid degradation
    Rvan_2233
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rvan_2233
   00310 Lysine degradation
    Rvan_2233
   00360 Phenylalanine metabolism
    Rvan_2233
   00380 Tryptophan metabolism
    Rvan_2233
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rvan_2233
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rvan_2233
   00281 Geraniol degradation
    Rvan_2233
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rvan_2233
   00627 Aminobenzoate degradation
    Rvan_2233
   00930 Caprolactam degradation
    Rvan_2233
Enzymes [BR:rva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rvan_2233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ADP71458
JGI: Rvan_2233
UniProt: E3I397
Position
2452096..2452893
Genome map
AA seq 265 aa AA seqDB search
MTSASSETASFETVLFEKKGRVGLVTLNRPKALNALNAQLIAELNQVLDACEADADIGAI
VITGSEKAFAAGADIKEMKDKTFGDVILQDFIAPWERITRVRKPVIAAVSGFALGGGCEL
AMMADFIIASDTAKFGQPEIMLGVIPGAGGTQRLTRAVGKAKAMDLILTGRHMDAAEAER
AGLVARVVPAADLVAEALKAAEKIASFSLPSAMLAKESVNRAFETTLAEGVRFERHAFHA
LFATEDQKEGMAAFAEKRPPQFKHA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgcatcttccgaaaccgcgtcattcgaaacggtgctctttgagaaaaagggc
cgggtcggcctcgtcacgctgaaccgtcccaaggcgctgaacgcgctcaacgcgcagctc
atcgcggaactcaatcaggtgctcgacgcctgcgaggccgatgcggacatcggggctatc
gtaatcaccggctccgagaaggcattcgcggcgggcgcggacatcaaggaaatgaaggac
aagaccttcggcgatgtgatcctgcaagacttcatagcgccgtgggagcgcatcacgcgc
gtccgcaagccggtgatcgcggccgtctcgggctttgcgctgggcggcggctgcgaactc
gccatgatggcagacttcatcatcgcatccgacacggcgaagttcggccagccggaaatc
atgctgggggtgatccctggcgcgggcggcacgcagcggctcacgcgcgcggtcggcaag
gcgaaggcgatggacctcattctcaccgggcgccacatggacgctgccgaggccgagcgc
gccgggctcgtggcgcgcgtcgtccccgccgccgatctcgtcgcggaggcgctgaaagcc
gccgagaagatcgcgagcttctcgctgccctcggccatgctggcgaaggaatcggtcaat
cgggctttcgagacgacgctcgccgaaggggtgcgtttcgagcgccacgcgttccacgcg
ctgttcgcgacggaggatcagaaagaaggcatggcggccttcgccgagaaacggcccccg
caattcaagcacgcgtaa

DBGET integrated database retrieval system