KEGG   Rhodomicrobium vannielii: Rvan_2699Help
Entry
Rvan_2699         CDS       T01353                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
rva  Rhodomicrobium vannielii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rva00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2933319..2934632)
Genome map
AA seq 437 aa AA seqDB search
MTASGTSLERWGDALVRHCAAKIPHAISATSLVKERPGFGQTVRPAPGSVLASAASTELD
YFFHWLRDSALIIDATRLLIRRGIDADSWVRRYHDFVHFSLGLNAIDGRALVAAGGFRER
ARADHLKYIRPNEELSAVQGDRVPGDVRFNADGTIDYFDWHRPQNDGPALRALTCLRFAD
DGIGSAAADALIRGDLAYTARNAGAPCYDIWEEDWAQHYNTVIAQYAALRHGARWAEARG
EAAFAAELGARRDELADLLERYWDESRGLLRSRLPGGENADEKALDFSLILGVVHAGLES
GAHSVADPRVRTTFLWQQAMFRDTYAINAGRSSGIMFGRYKGDTYISGGAWYISTFAAAE
YHYRLAVAVPNEREEYIAGGDAILARVRQFVPASGDLSEQFDQTTGEPTSAEDLTWSYAG
FISAWAAREAALSQAGA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacggcttcgggaacctcgctcgaacgctggggcgatgcgcttgtgcggcactgcgcg
gcgaagatcccgcatgcgatctcggccacgtcgctggtgaaggagcgaccgggcttcggc
cagacggtgcggcccgcgccgggatcggtgctggcgagcgcggcttctaccgaactcgac
tatttctttcattggctgcgggacagtgcgctcatcatcgacgcgacgcgcttgcttatc
cggcgcggcatcgacgctgactcatgggtgcgccgctaccacgacttcgtgcatttcagc
ctcggccttaacgccatcgatggccgcgcactcgttgcggcgggcggcttccgcgaacgc
gcgcgggccgaccatctgaaatacatccgtccgaacgaggagctttccgccgtgcaaggc
gaccgcgtgccgggcgacgtgcgcttcaacgcggacggcaccatcgactatttcgactgg
caccgcccgcagaacgatggcccggctctccgcgcgctcacctgcctgcgcttcgccgac
gacggcatcggcagcgctgcggcggacgcgctcattcgcggcgacctcgcctacaccgca
cgcaacgcgggcgcgccctgctacgacatctgggaagaagactgggcgcagcattataat
accgtgatcgcgcaatacgcggcgctacgtcatggcgcgcggtgggcggaagcgcgcggc
gaagcggccttcgcggccgagcttggtgcgcggcgcgacgagcttgctgatctgcttgag
cgctactgggacgaaagccggggccttctccgcagtcgccttccgggcggggaaaatgcg
gacgaaaaggcgctcgacttctcgctgatcctcggcgtggtccatgccggtctcgaaagt
ggcgcgcacagcgtggccgatccgcgcgtgcggacaacctttctctggcagcaggcgatg
ttccgcgacacttacgcgatcaacgcggggcgctcatccggcatcatgttcggccgctat
aagggcgacacctatatcagcggcggcgcgtggtatatcagcaccttcgcggcggcggag
tatcattaccggctggcggtcgccgtacccaacgagcgcgaggaatacatcgctggcggt
gacgcgatcctcgctcgcgtgcgccagttcgtccctgcttcgggcgacctctccgaacaa
ttcgaccagaccaccggcgagccgacatccgccgaagaccttacatggagctatgcgggt
ttcatcagcgcgtgggcggcgcgtgaagctgcgctttcacaagctggagcctga

DBGET integrated database retrieval system