KEGG   Rhodomicrobium vannielii: Rvan_2699Help
Entry
Rvan_2699         CDS       T01353                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00500  Starch and sucrose metabolism
rva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rvan_2699
Enzymes [BR:rva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Rvan_2699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ADP71910
JGI: Rvan_2699
UniProt: E3I7J1
Position
complement(2933319..2934632)
Genome map
AA seq 437 aa AA seqDB search
MTASGTSLERWGDALVRHCAAKIPHAISATSLVKERPGFGQTVRPAPGSVLASAASTELD
YFFHWLRDSALIIDATRLLIRRGIDADSWVRRYHDFVHFSLGLNAIDGRALVAAGGFRER
ARADHLKYIRPNEELSAVQGDRVPGDVRFNADGTIDYFDWHRPQNDGPALRALTCLRFAD
DGIGSAAADALIRGDLAYTARNAGAPCYDIWEEDWAQHYNTVIAQYAALRHGARWAEARG
EAAFAAELGARRDELADLLERYWDESRGLLRSRLPGGENADEKALDFSLILGVVHAGLES
GAHSVADPRVRTTFLWQQAMFRDTYAINAGRSSGIMFGRYKGDTYISGGAWYISTFAAAE
YHYRLAVAVPNEREEYIAGGDAILARVRQFVPASGDLSEQFDQTTGEPTSAEDLTWSYAG
FISAWAAREAALSQAGA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacggcttcgggaacctcgctcgaacgctggggcgatgcgcttgtgcggcactgcgcg
gcgaagatcccgcatgcgatctcggccacgtcgctggtgaaggagcgaccgggcttcggc
cagacggtgcggcccgcgccgggatcggtgctggcgagcgcggcttctaccgaactcgac
tatttctttcattggctgcgggacagtgcgctcatcatcgacgcgacgcgcttgcttatc
cggcgcggcatcgacgctgactcatgggtgcgccgctaccacgacttcgtgcatttcagc
ctcggccttaacgccatcgatggccgcgcactcgttgcggcgggcggcttccgcgaacgc
gcgcgggccgaccatctgaaatacatccgtccgaacgaggagctttccgccgtgcaaggc
gaccgcgtgccgggcgacgtgcgcttcaacgcggacggcaccatcgactatttcgactgg
caccgcccgcagaacgatggcccggctctccgcgcgctcacctgcctgcgcttcgccgac
gacggcatcggcagcgctgcggcggacgcgctcattcgcggcgacctcgcctacaccgca
cgcaacgcgggcgcgccctgctacgacatctgggaagaagactgggcgcagcattataat
accgtgatcgcgcaatacgcggcgctacgtcatggcgcgcggtgggcggaagcgcgcggc
gaagcggccttcgcggccgagcttggtgcgcggcgcgacgagcttgctgatctgcttgag
cgctactgggacgaaagccggggccttctccgcagtcgccttccgggcggggaaaatgcg
gacgaaaaggcgctcgacttctcgctgatcctcggcgtggtccatgccggtctcgaaagt
ggcgcgcacagcgtggccgatccgcgcgtgcggacaacctttctctggcagcaggcgatg
ttccgcgacacttacgcgatcaacgcggggcgctcatccggcatcatgttcggccgctat
aagggcgacacctatatcagcggcggcgcgtggtatatcagcaccttcgcggcggcggag
tatcattaccggctggcggtcgccgtacccaacgagcgcgaggaatacatcgctggcggt
gacgcgatcctcgctcgcgtgcgccagttcgtccctgcttcgggcgacctctccgaacaa
ttcgaccagaccaccggcgagccgacatccgccgaagaccttacatggagctatgcgggt
ttcatcagcgcgtgggcggcgcgtgaagctgcgctttcacaagctggagcctga

DBGET integrated database retrieval system