KEGG   Rhodomicrobium vannielii: Rvan_3297Help
Entry
Rvan_3297         CDS       T01353                                 

Definition
tRNA(Ile)-lysidine synthetase
Orthology
K04075  
tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
rva  Rhodomicrobium vannielii
Brite
Enzymes [BR:rva01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     Rvan_3297
Transfer RNA biogenesis [BR:rva03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Rvan_3297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3590906..3592360)
Genome map
AA seq 484 aa AA seqDB search
MGDQIAYCRSVATPIHFDDARGAERRPQNDGRTVPTVINDSEIRKAFASVEASPALVLAV
SGGPDSMALMHLARRWATLASRQAATITVATVDHGLRPESAEEATFVKAHARALGFEHVT
LVWSGEKPSAGLQAAARRARYALLTAQARVNGASLLTAHTRDDQAETLIMRLSRGSGVDG
LSAIAPVSGRDGVRLVRPLLGFSKTRLTAYLRARHVPFVRDPSNENTAFERVRLRLAMKA
LANAGVSKAALALSAARLGRSRAALDEAAERFLDGFFRVSPLAHGEIDREAFDALPDEIA
LRVLARVLPLVGGRAEPPRMMRLERLLENLRSRNSEATLGGSLMIAAAGRLSFYREPGRM
KPEPLFLEPRVAVLWDRRFLVSAPTAAACEGQVRPLGEPGWTAWRKERKQLGLSAEANRL
AALATPALWRVDKLLAAPVISGEGYASAVPSVTAKLAPPLARFLTRLPNTTSSALGKDTP
IPYL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgggggatcaaatcgcttattgccgaagtgtggcgacgccgatccacttcgatgacgca
agaggggcggaacggcgaccacaaaacgacggtaggacagtgccgactgttataaacgat
agcgaaatcaggaaagccttcgcctcggtggaggcatcccccgccctcgtgcttgcggta
tccggcggccctgacagcatggcgctgatgcatctcgcgcggcgctgggcgacgctcgcg
agtcggcaggccgccaccatcacggtcgcgaccgtcgatcatggcttgcgtcccgaaagc
gcggaggaagcgaccttcgtcaaggcgcacgcgcgcgctctcggcttcgagcacgtcacg
ctcgtgtggagcggcgagaagccttccgccggtcttcaggcagcggcgcgacgcgcccga
tacgccttgctcacggcgcaggcgcgggttaacggcgcgagccttctcacggcgcacacc
cgcgacgatcaggcggagacgctcatcatgcgactttcgcgcggcagtggcgtcgacggg
ttgtccgccatcgcaccggtatcggggcgggatggcgtgcgacttgtccgcccgctcctt
gggttttcgaagacgcggcttaccgcctatctgcgcgcgcgccacgtgccgtttgtccgc
gacccaagcaacgagaataccgctttcgagcgcgtacgccttcgcctcgccatgaaggcg
ctggcgaatgccggcgtctcgaaagccgcgctcgcgctcagtgccgctcgcctcggacgt
agccgcgccgcgctagacgaagcggccgagcgtttcctcgacgggtttttccgggtgtcg
ccgctcgcgcatggcgagatcgaccgcgaagctttcgacgcgctgcccgacgaaatcgcg
ctccgggtgctggcccgcgtgctgccgctcgtcggcggaagggccgaaccaccgcgcatg
atgcgccttgagcgacttctcgaaaatttgaggtcaaggaacagcgaggcgacgctgggc
ggttcgctcatgatcgcggcggcgggccgcctctccttctaccgcgagccgggccgcatg
aagcctgaacctctatttctggaaccccgcgtcgcggttctatgggatcgccgatttctg
gtctcggcaccgaccgctgccgcctgtgaggggcaagtccggccgctcggagagcccggc
tggacggcgtggcgcaaggaacgcaagcaactcggtctgtccgccgaggccaaccggctc
gccgcgctcgccacgcccgcgctctggcgcgtagacaaacttctggccgctcccgtgatc
tcgggcgaaggttacgcgtccgccgttccgtccgtcacagcaaagcttgccccccctctt
gcacggtttttaacccgcttgccaaacacgacctcaagtgcgcttggcaaagacacaccc
ataccctatctttga

DBGET integrated database retrieval system