KEGG   Rhodomicrobium vannielii: Rvan_3330Help
Entry
Rvan_3330         CDS       T01353                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rva  Rhodomicrobium vannielii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rvan_3330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rvan_3330
   00052 Galactose metabolism
    Rvan_3330
   00500 Starch and sucrose metabolism
    Rvan_3330
   00520 Amino sugar and nucleotide sugar metabolism
    Rvan_3330
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rvan_3330
   00524 Butirosin and neomycin biosynthesis
    Rvan_3330
Enzymes [BR:rva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rvan_3330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3627128..3628048)
Genome map
AA seq 306 aa AA seqDB search
MTPWRLIADVGGTNVRFARVFDGLVVAERRAYQGARFESFIHAMRAYAAETGGLAGCASV
AIGAAGPVAAGEIHLTNIAWTIREAEVEAEAGAPCTLLNDVEAAAYGALTLTEPDYALLS
GPAPDLSRAMRLLIANIGTGFGAAALFKVANVWVSCPSEAGHMSLRLPDDAPAGLRSAFP
SVEHALSGRGLVDLHAALSGRDDGLSARDICANAAYDPAAAATIRLFAEITGSVLGDLTL
AYTAWDGVFLVGSVAKGCAATDPRAMRAAFENKGPMSDRLKAVPVALMLKEDPAFFGLAI
APMRTR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgtggcgtctcatcgccgacgtgggcggcacgaatgtgcggttcgcgcgcgtg
ttcgatggccttgtcgttgctgagcgccgcgcttatcagggtgcgcgcttcgaaagcttc
attcatgcgatgcgcgcttatgcggccgagaccggcggtcttgcgggctgcgcttcggtc
gccatcggtgcggctgggcctgtcgcggcgggcgaaattcacctgaccaacatcgcctgg
acgatccgcgaggcggaggtcgaggcggaggcgggcgccccctgcacactgctcaacgat
gtcgaggcggcggcctatggtgcgctcacactgacggagccggattacgcgctgttgagt
ggcccggcaccggacctgagccgggcaatgcgcctcctcatcgcgaatatcggcaccggc
ttcggcgcggcggcgctgttcaaggtggcgaacgtgtgggtttcgtgtccgagcgaggcg
gggcatatgtcgctgcgcctgccagacgatgcccctgctggtttgcggtcggcttttccc
tccgtggagcatgcactttccgggcgcggccttgtcgaccttcacgcggcgctcagcgga
cgcgatgacgggctgtccgcgcgcgacatctgcgccaatgccgcgtacgatcccgcagcg
gcggctacaatccgtctcttcgccgaaatcaccggaagcgtactcggcgacctgacgctc
gcctatacggcgtgggacggtgtgttcctcgtcggcagcgtcgccaagggctgcgccgcc
accgatccgcgcgcgatgcgtgccgcgttcgagaacaaggggccaatgtcggaccggctg
aaggctgtgcccgtcgccctcatgctgaaggaagaccctgcgttcttcggcctcgcgatc
gcgccgatgcgcacgcgctaa

DBGET integrated database retrieval system