KEGG   Rhodomicrobium vannielii: Rvan_3378Help
Entry
Rvan_3378         CDS       T01353                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rva  Rhodomicrobium vannielii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rva00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rvan_3378
DNA repair and recombination proteins [BR:rva03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rvan_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3683488..3684102)
Genome map
AA seq 204 aa AA seqDB search
MLPPQKKSSGAEIEELIALLAKLPGLGPRSARRAALHLIKKREQLLLPLARALGVAADKI
AICKECGNIDTQQPCAICADASRDASTICVVEEVGDLWALERAAIVRSRYHVLGGTLSPL
DGRGPDDLFLVKLMERARQPGVNEIILALNATVEGQSTAHYIAAELEGLPLKVTRLARGV
PIGGELDYLDEGTLAAAIKLRQPI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaccgcaaaagaaatcctctggcgccgaaatcgaagagctgatcgcgctgctc
gcaaagctgccggggctcggaccacgctccgcacgccgcgcggcgctccacctcatcaag
aagcgcgagcagcttctcctgccgctcgcccgcgcgttgggcgtcgccgccgacaagatc
gcgatctgcaaggaatgcggcaacatcgacacgcagcagccctgcgcgatttgcgcggac
gcgagccgcgacgcctccacgatctgcgtggttgaggaggtgggcgacctgtgggcgctg
gagcgggcggccatcgtgcgctcgcgctatcacgtgctcggcggcacgctgtcgccgctc
gacgggcgcgggccggacgacctcttcctcgtcaagctgatggagcgcgcgcgccagccc
ggcgttaacgaaatcatcctcgcgctcaacgccacggtggaaggtcaatcgacggcgcat
tacattgcggcagagctggaaggcttgccgctgaaggtgacgcgtcttgcgcgcggcgtg
cccatcggcggcgaattggactatctcgacgaaggaacgctcgctgccgcgatcaagctt
cgtcagccgatctga

DBGET integrated database retrieval system