KEGG   Rhodomicrobium vannielii: Rvan_3528Help
Entry
Rvan_3528         CDS       T01353                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rva  Rhodomicrobium vannielii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rvan_3528
   00030 Pentose phosphate pathway
    Rvan_3528
   00051 Fructose and mannose metabolism
    Rvan_3528
   00052 Galactose metabolism
    Rvan_3528
   00500 Starch and sucrose metabolism
    Rvan_3528
   00520 Amino sugar and nucleotide sugar metabolism
    Rvan_3528
  Nucleotide metabolism
   00230 Purine metabolism
    Rvan_3528
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rvan_3528
Enzymes [BR:rva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rvan_3528
    5.4.2.8  phosphomannomutase
     Rvan_3528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3839447..3840958)
Genome map
AA seq 503 aa AA seqDB search
MTAAAFPKPRTDLKPNTAEFERLPYVKPTGFREYDARWLFPQEINLMGMQALGIGLATLM
RERGVPVRIVTGHDYRSYSSSIKYALISGMLAGGAEVHDIGLALSPMAYFGQFALEVEGV
AMVTASHNDNGWTGIKLGMARPLTFGPEDMSELKAIVLEGRFAPHEGGTYRFHGDIAARY
IADLTDREPFTRKIKAVVACGNGTAGVFAPEVLAKLGVDVIPLNTDLDYNFPNHNPNPES
LKMLHAVSNAVRLSGADVGLAFDGDGDRCGVVDNEGTEIFADKVGVMLARDISGLHKDAK
FVVDVKSTGLFTTDPVLVKNGAHTAYWKTGHSYIKRYSHQTGALVGFEKSGHYFFNPPLG
RGYDDGIVSGVAICDMLSRNPGKTMAELHRELPKTWQSPTMSPHCDDEKKYEVVDRVIAH
FKAIADKGGEIAGQKIRDVITVNGIRLVLEDGTWGLVRASSNKPELVVVVESPTSEANMR
AIFAEIDQHLATYPEIGEYNQKI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgcagcattccccaagccgcgcacggacctcaagcctaacacggcggaattc
gagcgtcttccgtatgtgaagccgacgggttttcgcgaatacgacgcgcgctggctgttc
ccgcaggaaatcaacctgatggggatgcaggcgctcggcatcgggctcgcgacgttgatg
cgcgagcggggcgtgccggtgcgcatcgtgaccggccacgattaccgctcctattcgtcg
agcatcaaatacgcgctcatttccggtatgctcgcgggcggcgcggaggtgcacgatatc
gggcttgcgctctcgccgatggcctatttcggacagttcgcgctcgaagtggaaggcgtg
gcgatggtcacggcaagtcacaacgacaatggctggaccggcatcaagctcgggatggcg
cggccgctcaccttcggccccgaagatatgagtgaactcaaggcgatcgtgctcgaaggc
cgcttcgcgccgcatgaaggcggcacatatcgtttccacggcgacatcgccgcgcgctat
atcgcggatctcaccgaccgcgaaccgttcacgcgcaagatcaaggccgtcgtcgcgtgc
ggcaacggcacggctggcgttttcgcgcctgaggtgctggcgaagctcggcgtcgatgtg
atcccgctgaacaccgacctcgactacaatttcccgaaccacaacccgaacccggaatcg
ctgaagatgctgcacgcggtgtcgaacgcggtgcggctctccggcgcggatgtcggcctc
gccttcgacggcgacggcgaccgttgcggcgtggtcgacaacgaaggcacggagattttc
gccgacaaggttggcgtcatgctcgcgcgcgatatttcggggctccacaaggacgcgaaa
ttcgtggtggacgtgaagtccaccggcctgttcaccacggacccggtgctcgtcaagaac
ggcgctcacaccgcctattggaagacgggccactcctacatcaagcgctacagccaccag
acgggcgcgctcgtcggtttcgagaagtcgggccactacttcttcaacccgccacttggg
cgcggctatgacgacggcatcgtgtctggcgtcgccatttgcgacatgctttcgcgcaac
cccggcaagaccatggccgagttgcaccgcgaactgccgaagacgtggcaatcgccgacc
atgtcgccccattgcgacgacgagaagaaatatgaggtggtcgatcgcgtgatcgcgcat
ttcaaggcgattgccgacaagggcggcgagatcgcgggccagaagatccgcgatgtcatc
acggtgaacggcatccgcctcgtgctcgaagacggcacgtggggcctcgtgcgcgcgtca
tcgaacaagccggaactcgtcgtcgtcgtggaaagcccgacctcggaggccaacatgcgc
gcgatcttcgccgagatcgaccagcatctcgccacctatcccgagatcggcgaatacaat
cagaagatctga

DBGET integrated database retrieval system