KEGG   Rhodomicrobium vannielii: Rvan_3597Help
Entry
Rvan_3597         CDS       T01353                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00010  Glycolysis / Gluconeogenesis
rva00620  Pyruvate metabolism
rva00640  Propanoate metabolism
rva00680  Methane metabolism
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rvan_3597
   00620 Pyruvate metabolism
    Rvan_3597
   00640 Propanoate metabolism
    Rvan_3597
  Energy metabolism
   00680 Methane metabolism
    Rvan_3597
Enzymes [BR:rva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rvan_3597
Lipid biosynthesis proteins [BR:rva01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rvan_3597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADP72768
JGI: Rvan_3597
UniProt: E3I4U6
Position
complement(3910316..3912376)
Genome map
AA seq 686 aa AA seqDB search
MPPYKTSGCGSPWRTAGRLPQRIANIQSMRQMVQSEVYPVPPEFAARAHVDAAAYERLYR
WSIEDPDGFWKKEAAFLDWIKPFTEVSDTSFDVNNFRVRWFADGTLNGSVNCIDRHLAAK
ADKPAVFWEGDTPGESRVVTWGELADKVNRLANVLKSLGVGKGDVVAIYLPVIPEVMVAM
MATIRIGAVHTVVFSGFSAESLENRIADSKAKVLITADEGFRGGRISPLKRNADDAVRNQ
PSIEHVIVVRRSGAEVPFTPGRDLWYDEATEAADPWCEPVEVGAEDPLFILYTSGSTGKP
KGLVHTTAGYLVHAGTSWRIIFDWHEGDVFWSTADVGWVTAHSYKLYGPLLNGATTVMFE
GVPSWPDASRWWSIIEKHRVNIFYTAPTALRSLMREGEAPVRKHDLSSLRVLGSVGEPIN
PEAWRWFHSVIGGGRCPIVDNYWQTETGAVTLVPIPGAIPNKPGMAAKPYFGIRPEVVSP
EGVTLEGPAEGNMCFRGSWPGQARTILHDHERFLKTYFAPFPGRFFSGDGVTRDEDGYYR
IAGRVDDVINVSGHRLGTVELESAIASHPAVAEAAVVGYNHDVKGQGVFAYVTLKADMPE
TEELRAEIRQWVRARISPIASPDIVQWAPALPKNRAGKILRRILLKIANNDFSDFGDTST
LADASVVEDIIARRKAELAKLTRENA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
gtgcctccctataagacttccggctgtggttcaccctggcgaaccgcggggcgcctgccg
caacgcatcgccaacattcagtcaatgagacagatggttcagtccgaagtttacccggtg
ccgccggaattcgctgcccgcgcgcatgtcgacgcggctgcctatgaacgcctctaccgc
tggtccatcgaagacccggacgggttctggaagaaggaggccgcgttcctcgactggatc
aagccgttcacagaggtgtcggacaccagtttcgatgtgaacaacttccgcgtccgctgg
ttcgccgacggcacgctcaacggctcggtcaactgcatcgaccgccatcttgccgcgaag
gccgacaaacccgccgtcttctgggaaggcgatacgccgggagaaagccgcgtcgtcacg
tggggcgaactcgcggacaaggtgaaccgccttgcgaacgtcctcaaaagcctcggcgtg
ggcaagggcgatgtggtcgcgatctatctgcccgtgatccctgaggtgatggtggcgatg
atggccacgatccgcatcggcgcagtccatacagtagtgttctccggcttctcggcggaa
tcgctcgaaaatcggatcgcggattcgaaagcgaaggttctcataaccgccgacgaaggt
tttcgcggcgggcgcatctcaccgctgaagcgcaacgccgacgacgcggtgcgaaaccag
ccgagcatcgaacacgtgatcgtcgtgcgccgctcgggcgccgaggttccgttcacaccg
ggccgagacctttggtacgacgaggcgacggaggctgcagacccgtggtgcgagccggtc
gaagtgggcgcggaagacccgctcttcattctttatacatccggttcgaccggcaagccg
aaggggctcgttcacacgaccgccggttatctcgtgcatgcggggacgtcgtggcgcatc
atcttcgactggcatgagggcgatgtgttctggtcgaccgccgatgtcggctgggtcacg
gcgcacagctacaaactctacgggccgctgctcaacggcgcgacgactgtcatgttcgaa
ggcgtgccgagctggcccgatgcgtcgcgctggtggtcgatcatcgaaaagcaccgcgtc
aatatcttctacaccgccccaacggcattgcgttccctcatgcgcgaaggcgaggcacca
gtcaggaagcacgatctgtcgagcctgcgcgtgctgggctcggtgggcgagccgatcaat
ccagaggcgtggcgctggtttcattccgtgatcggcggcgggcgctgccccatcgtcgat
aattactggcagaccgaaacgggcgcggtgacgctcgtgccgatccccggcgcgatcccg
aacaagccgggcatggcggcgaagccctatttcggcattcgccctgaggtggtcagcccc
gaaggcgtgacgcttgaaggcccggctgaaggaaacatgtgcttccgcggttcgtggccc
ggacaggcgcgcaccatactgcacgatcacgagcgcttcctgaaaacctatttcgcgccg
tttccggggcgcttcttctcaggcgacggcgtcacccgcgacgaggacggctactaccgc
atcgccggacgcgtggacgatgtcatcaacgtgtcgggccatcggctcggaactgtggaa
ctcgaaagcgccatcgcctcccaccccgccgtcgcggaagctgcggtcgttggatataat
cacgacgtgaaggggcaaggggttttcgcctatgtcacgctcaaggccgacatgccggaa
acggaggaattacgcgccgagatcaggcaatgggtgcgcgcgcgtatcagtcctatcgcc
tcgcccgacatcgtccagtgggcaccggcgctgccgaaaaaccgcgcgggcaagatcctc
cgccgcatcctcctgaagatcgccaacaacgatttttcggatttcggcgacacctccacg
ctcgccgacgcgtctgtcgtcgaagacatcattgcccgccgcaaggccgaactcgcaaaa
cttaccagggaaaacgcatga

DBGET integrated database retrieval system