KEGG   Rubrobacter xylanophilus: Rxyl_0056Help
Entry
Rxyl_0056         CDS       T00368                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rxyl_0056
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_0056
  Lipid metabolism
   00071 Fatty acid degradation
    Rxyl_0056
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rxyl_0056
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rxyl_0056
   00626 Naphthalene degradation
    Rxyl_0056
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rxyl_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
57615..58604
Genome map
AA seq 329 aa AA seqDB search
MRAMVLRAPGGPLRPEELPVPEPGSGEVLVRVRACGVCRTDLHVVDGELREPKLPLVVGH
QIVGVVERVGEGVERFSPGDRVGVPWLGRTCGRCRYCRTGRENLCGEARFTGYQLDGGFA
EYARADARFCLPVPEGYPDLQAAPLLCAGLIGYRALRMAGDAERLGLYGFGASAHIILQV
ARHQGRRVFAFTRDGDEEAQRFARRLGAEWAGGSGQRPPEELDAAIIFAPVGALVPLALR
AVARGGTVVCAGIHMSDIPSFPYELLWGERQLRSVANLTRRDGEEFLALAPEVPVRTEVR
PYPLEGANQALDDLRSGRLTGAAVLVVGR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggcgatggtgttgagagcgccgggcggcccgctccgcccggaagagctgcccgtc
ccggagcccggatccggcgaggtgctcgtcagggtccgggcctgcggcgtctgccgcacc
gatctgcacgtggtggacggcgagctgcgggagccgaagctcccgctcgtggtggggcac
cagatcgtcggggtcgtcgagagggtcggggagggggtggagcgcttctccccgggcgac
cgggtcggcgtgccctggctcggccggacctgcggccggtgccgctactgccgcacgggg
cgggagaacctctgcggtgaggcgcgcttcaccggctaccagctcgacggcggcttcgcc
gagtacgcgagggccgacgcccgcttctgcctcccggtgccggagggttacccggacctg
caggccgcgccgctcttgtgcgcgggcctcatcggctaccgggcgctccgcatggcgggc
gacgccgagaggctcgggctctacggtttcggggcctcggcccacatcatcctccaggtc
gcccggcaccaggggcggcgggtcttcgccttcacccgcgacggcgacgaggaggcgcag
cggttcgcccggaggctcggcgcggagtgggccgggggctcggggcagaggccgcccgag
gaactcgacgccgccatcatcttcgccccggtgggggcgctcgtgccgctcgcgctccgg
gccgtggcgcgaggcgggacggtcgtctgcgcgggcatccacatgagcgacatcccctcc
ttcccctacgagctgttgtggggggagcggcagctgcgctcggtggcgaacctcacccgc
cgcgacggggaggagttcctcgcgctggccccggaggtgccggtgcgcaccgaggtcagg
ccctacccgctggagggggccaaccaggcgctggacgacctgcggtcggggaggctcacc
ggcgcggcggtgctggtggtggggcggtag

DBGET integrated database retrieval system