KEGG   Rubrobacter xylanophilus: Rxyl_0147Help
Entry
Rxyl_0147         CDS       T00368                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00625  Chloroalkane and chloroalkene degradation
rxy00680  Methane metabolism
rxy01100  Metabolic pathways
rxy01120  Microbial metabolism in diverse environments
rxy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Rxyl_0147
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rxyl_0147
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Rxyl_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C 3HCDH_N FAD_binding_3 Pyr_redox_2 FAD_binding_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABG03126
JGI: Rxyl0147
UniProt: Q1AZQ2
Position
complement(152969..154141)
Genome map
AA seq 390 aa AA seqDB search
MRAVVYKGPFEVAVENVEDPKIQDPNDVVVRITSTCICGSDLHMYEGRTAAEPGIVFGHE
NLGIVEEVGPGVVSLRQGDRVVMPFNVACGFCKNCQRGYTGFCLTVNQGFAGGAYGYVAM
GPYTGGQAEYLRVPFADFNCLKLPEGDEHEADFALLADIFPTGYHGTELADVQPGETVAV
FGAGPVGLMAAYSAMIRGAERVFVVDRVKERLDKAEEIGCIPVNFDEVDPVEYIKEQTPG
NRLSTLSVDNDANRGADKGIDAVGYQAHVRGGEREEPAIVLNTLIECVRPTGALGVPGLY
VPSDPGAPDDASKKGQLLVSIGRMFEKGLRMGTGQCNVKRYNAYLRDLIIAGRARPSFVV
SHEVPLDQAPEAYEKFDKRIEGYTKVILKP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagagccgtagtgtacaagggcccgttcgaggtagccgtagagaacgtcgaggacccg
aagatccaggaccccaacgacgtggtggtgaggatcacctcgacctgtatctgcggcagc
gacctgcacatgtacgagggccgcaccgcggcggagccgggcatcgtcttcgggcacgag
aacctgggcatcgtggaggaggtggggccgggcgtcgtctcgctgcgccagggcgaccgc
gtggtgatgcccttcaacgtggcctgcgggttctgcaagaactgccagcggggctacacc
ggcttctgcctgacggtgaaccaggggttcgccggcggggcctacggctacgtggcgatg
gggccctacaccggcggccaggccgagtacctgcgggtgcccttcgcggacttcaactgc
ctgaagctgcccgagggggacgagcacgaggcggacttcgccctgctcgcggacatcttc
cccaccggctaccacggcaccgagctggccgacgtgcagcccggggagacggtcgcggtc
ttcggcgccggccccgtgggcctgatggcggcgtacagcgccatgatccggggcgccgag
cgggtcttcgtggtcgaccgggtcaaggagcggctggacaaggccgaggagatcggctgc
atcccggtgaacttcgacgaggtcgacccggtggagtacataaaggagcagacgccgggc
aaccgcctctccacgctgtcggtggacaacgacgccaaccggggagcggacaagggcatc
gacgcggtcggctaccaggcgcacgtccgcggcggcgagcgggaggagcccgcgatcgtg
ctgaacaccctgatcgagtgcgtccgcccgacgggggccctgggggttcccggcctctac
gtcccctccgacccgggggccccggacgacgcctcgaagaagggccagcttctggtctcc
atcgggcggatgttcgagaagggcctgaggatgggcacgggccagtgcaacgtcaagcgc
tacaacgcctacctgcgcgacctgatcatcgccggccgcgccaggccctccttcgtggtc
tcccacgaggtgccgctcgaccaggcccccgaggcctacgagaagttcgacaagcggata
gagggctacaccaaggtcatcctcaagccgtag

DBGET integrated database retrieval system