KEGG   Rubrobacter xylanophilus: Rxyl_0251Help
Entry
Rxyl_0251         CDS       T00368                                 

Definition
amylomaltase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rxyl_0251
Enzymes [BR:rxy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rxyl_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(256838..258289)
Genome map
AA seq 483 aa AA seqDB search
MRLERSAGILLHPTSLPGPRPSGELGPEALRFARFLQGAGQRLWQVLPLNPTDEGGSPYS
SYSAFAGNPLLVSAEWLAEDGLIEGAPREAPAPRVDYRRALAAKGRLLREAYSRWRPDEG
FERFREERSFWLEDYALFMALRGRLRRPWNRWPAGLATREPGALRSARRELAEEAGFHRF
TQYRFFRDWSRVRRAAPGVRIIGDLPIFVSHDSADVWAHRDLFLLDERGEPAAVAGVPPD
YFSETGQLWGNPLYDWERMRREGYRWWVERARAALALCDALRLDHFRGFAAFWAVPAGER
TAAGGRWVEGPGEGLFRVLSKELGGLPFIAEDLGEITPDVVRLRERLGLPGMKVLQFAFG
SGPENPFLPHNWRQESWVVYTGTHDNDTTAGWWLSAADGERAFARRYLGREYAGVWDFIR
LAYASAAGWAVIPMQDVLGLGTEARMNTPGTGEGNWEWRLGGEALTPNLAARLGELARTY
GRA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgcggctggagcgctcggccgggatcctgctccaccccacctccctgcccggaccccgc
ccctcgggggagctgggcccggaggcgctccggttcgcgcgctttctgcagggcgcggga
cagcggctctggcaggtgctgcccctgaaccccacggacgaggggggctccccctactcc
tcgtactcggcgttcgcgggcaacccgctgctcgtgagcgcggagtggctggcggaggac
ggcctgatcgagggcgcgccgcgcgaggcccccgccccccgggtggactaccggcgggcg
ctcgccgccaaggggcgcctgctgcgggaggcctactcccgctggaggcccgacgagggc
ttcgagcgcttccgcgaggagcggtccttctggctggaggactacgccctgttcatggcc
ctgcgggggcgactccggcgcccctggaaccgctggcccgcgggcctggccacccgggag
ccgggcgccctgcgctccgcccggcgggagctggccgaagaggctggcttccaccgcttc
acccagtaccgcttcttccgggactggtccagggtgcggcgcgccgcgcccggcgtgagg
atcataggggatctgcccatcttcgtctcccacgactcggccgacgtgtgggcccaccgg
gatctctttctgctggacgagaggggggagcccgccgctgtggccggcgtccccccggac
tacttctccgagaccggccagctctggggcaacccgctctacgactgggagaggatgcgc
cgggaagggtaccgctggtgggtggagcgggcgcgggcggcgctggccctgtgcgacgcg
ctgcgcctggaccacttccggggcttcgcggcgttctgggcggtgcccgcgggggagcgc
accgcggccgggggccgctgggtagagggcccgggagaggggctcttccgggtgctcagc
aaggagctgggcgggctgccgttcatcgcggaggatctgggcgagatcacgccggacgtc
gtgcggctgagggagcggctcgggcttccggggatgaaggtgctgcagttcgccttcggg
agcgggccggagaaccccttcctcccgcacaactggcggcaggagagctgggtggtctac
accggcacccacgacaacgacaccaccgccggctggtggctctccgccgcggacggggag
cgggccttcgcccggcgctacctggggcgcgagtacgccggggtgtgggacttcatccgg
ctggcctacgcctcggcggcgggttgggcggtgatcccgatgcaggacgtcctgggcctc
ggcacggaggcccggatgaacaccccgggcaccggggagggcaactgggagtggcgcctc
ggcggcgaggcgctgaccccaaatctggccgcgcgcctcggggagctcgcgcgcacctac
gggcgggcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system