KEGG   Rubrobacter xylanophilus: Rxyl_0252Help
Entry
Rxyl_0252         CDS       T00368                                 

Definition
peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rxyl_0252
Enzymes [BR:rxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Rxyl_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(258292..259344)
Genome map
AA seq 350 aa AA seqDB search
MPLNEPLLKRLIETPAVSGREERQREIAREVLGSLADEVRTDPLGSVIGTKRGREDVRVM
VAAHMDEIGFLVRHIDDRGFVRLQTLGGHDPANMVSQRVAIVTSGGETLRGALQPARKPP
HVAGEEERKRLPRAEEFFVDLGMEAEEVKARVRVGDYATMDRTLERVGGCYMGKAMDDRI
GLFVMYEALRTLREHEATIHAVATSQEEVGLRGATASGWGLEPTAVVALDITLAMDVPGG
QEDQQITALGKGAAIKIMDSSLICHPKLVEHFRSIAEREGIPHQMEILPRGGTDAGGVQR
LHGGIPAITLSIPCRYTHTPNEMVNASDVEACITLLARYLEEAHTGNYSL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgaacgagccgttgctcaagcgcctgatagagacgcccgccgtctcaggaagg
gaggagaggcagcgcgagatcgcccgggaggtgctcggctccctcgccgacgaggtgcgc
accgaccctctggggagcgtgatcgggacgaagcggggccgggaggacgtgcgggtcatg
gtcgccgcgcacatggacgagatcggctttctggtccgccacatcgacgataggggcttc
gtccgcctgcagacgctgggcgggcacgacccggcgaacatggtctcccagcgggtcgcc
atcgtgacctccggcggggagacgctgcgcggggcgctccagcccgcccgcaagccgccg
cacgtggccggcgaggaggagaggaagaggctgccccgggccgaggagttcttcgtcgac
ctggggatggaggcggaggaggtgaaggcgagggtgcgcgtcggggactacgccacgatg
gaccgcaccctggagcgggtcggcggctgctacatgggcaaggcgatggacgaccggata
ggcctcttcgtgatgtacgaggcgctgcggaccctgcgggagcacgaggccaccatccac
gccgtggccacctcgcaggaggaggtcgggctgcgcggggcgacggccagcgggtggggg
ctcgaaccgacggcggtggtcgcgctggacataacgctcgcgatggacgtccccggcggc
caggaggaccagcagatcaccgcgctcggcaagggcgcggccatcaagatcatggactcc
tccctgatctgccacccgaagctggtcgagcacttccgctccatcgccgagcgcgagggg
ataccgcaccagatggagatcctgccgcgcggcgggaccgacgcgggcggggtgcagcgg
ctgcacggcggcatcccggccatcaccctctcgatcccctgccgctacacgcacaccccg
aacgagatggtgaacgcttcggacgtggaggcctgcatcacgctgctggcccgctacctg
gaggaggcccacaccgggaactactcgctgtag

DBGET integrated database retrieval system