KEGG   Rubrobacter xylanophilus: Rxyl_0305Help
Entry
Rxyl_0305         CDS       T00368                                 

Definition
(GenBank) Tryptophan synthase, beta chain-like protein
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00260  Glycine, serine and threonine metabolism
rxy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01130  Biosynthesis of antibiotics
rxy01230  Biosynthesis of amino acids
Module
rxy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rxyl_0305
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rxyl_0305
Enzymes [BR:rxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rxyl_0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABG03281
JGI: Rxyl0305
UniProt: Q1AZ97
Position
complement(316723..318075)
Genome map
AA seq 450 aa AA seqDB search
MEPTKFVLGDEHIPQSWYNIVPDLPFALEPPLDPATREPVGPEAFAPIFPRAIIEQEVSA
EPRVPIPEEVRKIYGLWRPTPLFRARRLERLLDTPARIYYKYEGVSPTGSHKPNTAVPQA
YYNREEGVRRLTTETGAGQWGSSLAFACRQMGLECTVYMVRVSYDQKPYRRIMMQTYGAD
VHASPTDLTQAGRRILEEHPDSPGSLGIAISEAVEDAVGSEDAKYSLGSVLNHVLLHQTV
IGQEAIEQMELAGEYPDVVVGCAGGGSNFGGIAFPFLRENLLNGRDTRFIAVEPASCPTL
TKGRFTYDFGDTAGTTPLMKMYTLGHSFVPAGIHAGGLRYHGDSPILSALVHEGLVEARA
YLQNETFEAGVAFARAEGIVPAPEVNHAIKAVMDLALEAREAGEGRVILFNMCGHGHFDL
SAYERYLAGELVDLQLSQEEIDRALEGLPI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtggagcccacgaagttcgttctcggcgacgagcacatcccgcagagctggtacaacatc
gtgccggacctgccgttcgcgctggagccgccgctcgacccggccacccgcgagccggtg
ggtccggaggccttcgccccgatcttcccgcgcgccatcatcgagcaggaggtgagcgcc
gagccgcgcgtccccatcccggaggaggtgcgaaagatctacggcctctggcggcccacg
cccctcttccgcgcccggcgcctcgagaggctcctcgacacccccgcccgcatctactac
aagtacgagggggtctcccccaccgggagccacaagcccaacaccgccgtcccccaggcc
tactacaaccgcgaggagggcgtccggcgcctcaccaccgagaccggcgcggggcagtgg
ggctcctccctcgccttcgcctgccgccagatgggcctggagtgcaccgtctacatggtg
cgcgtctcctacgaccagaagccctaccgccgcatcatgatgcagacctacggcgcggac
gtccacgcgagccccacggacctcacgcaggcgggccgcaggatcctcgaggagcacccc
gactcccccggctcgctcgggatagcgatctccgaggccgtcgaggacgcggtcggcagc
gaggacgcgaagtattccttggggagcgtgctcaaccacgtgctcttgcaccagaccgtg
atcgggcaggaggccatagagcagatggagctcgccggcgagtacccggacgtggtcgtc
ggctgcgcgggcggcggctccaacttcggcgggatcgccttccccttcctgcgcgagaac
ctgctgaacgggagggacacccgctttatcgccgtggagcccgcctcctgcccgacgctc
accaagggccgcttcacctacgacttcggcgacaccgcgggcacgacgcccctgatgaag
atgtacacgttaggccactccttcgtcccggcggggatacacgccggggggctccgctac
cacggggactccccgatcctgtccgcgctcgtgcacgaggggctcgtggaggcgcgcgcc
tacctgcagaacgagaccttcgaggccggggtggcgttcgcgcgggccgagggcatagtc
cccgcgccggaggtcaaccacgccataaaggcggttatggacctggcgctcgaggcgagg
gaggccggggaggggcgcgtgatcctcttcaacatgtgcggccacgggcacttcgacctc
tcggcctacgagcgctacctggccggggagctcgtggacctgcagctctcgcaggaggag
atagaccgggcgctggaggggcttccgatctag

DBGET integrated database retrieval system