KEGG   Rubrobacter xylanophilus: Rxyl_0305Help
Entry
Rxyl_0305         CDS       T00368                                 

Definition
(GenBank) Tryptophan synthase, beta chain-like protein (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rxyl_0305
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rxyl_0305
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rxyl_0305
Enzymes [BR:rxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rxyl_0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(316723..318075)
Genome map
AA seq 450 aa AA seqDB search
MEPTKFVLGDEHIPQSWYNIVPDLPFALEPPLDPATREPVGPEAFAPIFPRAIIEQEVSA
EPRVPIPEEVRKIYGLWRPTPLFRARRLERLLDTPARIYYKYEGVSPTGSHKPNTAVPQA
YYNREEGVRRLTTETGAGQWGSSLAFACRQMGLECTVYMVRVSYDQKPYRRIMMQTYGAD
VHASPTDLTQAGRRILEEHPDSPGSLGIAISEAVEDAVGSEDAKYSLGSVLNHVLLHQTV
IGQEAIEQMELAGEYPDVVVGCAGGGSNFGGIAFPFLRENLLNGRDTRFIAVEPASCPTL
TKGRFTYDFGDTAGTTPLMKMYTLGHSFVPAGIHAGGLRYHGDSPILSALVHEGLVEARA
YLQNETFEAGVAFARAEGIVPAPEVNHAIKAVMDLALEAREAGEGRVILFNMCGHGHFDL
SAYERYLAGELVDLQLSQEEIDRALEGLPI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtggagcccacgaagttcgttctcggcgacgagcacatcccgcagagctggtacaacatc
gtgccggacctgccgttcgcgctggagccgccgctcgacccggccacccgcgagccggtg
ggtccggaggccttcgccccgatcttcccgcgcgccatcatcgagcaggaggtgagcgcc
gagccgcgcgtccccatcccggaggaggtgcgaaagatctacggcctctggcggcccacg
cccctcttccgcgcccggcgcctcgagaggctcctcgacacccccgcccgcatctactac
aagtacgagggggtctcccccaccgggagccacaagcccaacaccgccgtcccccaggcc
tactacaaccgcgaggagggcgtccggcgcctcaccaccgagaccggcgcggggcagtgg
ggctcctccctcgccttcgcctgccgccagatgggcctggagtgcaccgtctacatggtg
cgcgtctcctacgaccagaagccctaccgccgcatcatgatgcagacctacggcgcggac
gtccacgcgagccccacggacctcacgcaggcgggccgcaggatcctcgaggagcacccc
gactcccccggctcgctcgggatagcgatctccgaggccgtcgaggacgcggtcggcagc
gaggacgcgaagtattccttggggagcgtgctcaaccacgtgctcttgcaccagaccgtg
atcgggcaggaggccatagagcagatggagctcgccggcgagtacccggacgtggtcgtc
ggctgcgcgggcggcggctccaacttcggcgggatcgccttccccttcctgcgcgagaac
ctgctgaacgggagggacacccgctttatcgccgtggagcccgcctcctgcccgacgctc
accaagggccgcttcacctacgacttcggcgacaccgcgggcacgacgcccctgatgaag
atgtacacgttaggccactccttcgtcccggcggggatacacgccggggggctccgctac
cacggggactccccgatcctgtccgcgctcgtgcacgaggggctcgtggaggcgcgcgcc
tacctgcagaacgagaccttcgaggccggggtggcgttcgcgcgggccgagggcatagtc
cccgcgccggaggtcaaccacgccataaaggcggttatggacctggcgctcgaggcgagg
gaggccggggaggggcgcgtgatcctcttcaacatgtgcggccacgggcacttcgacctc
tcggcctacgagcgctacctggccggggagctcgtggacctgcagctctcgcaggaggag
atagaccgggcgctggaggggcttccgatctag

DBGET integrated database retrieval system