KEGG   Rubrobacter xylanophilus: Rxyl_0310Help
Entry
Rxyl_0310         CDS       T00368                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rxy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rxy00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rxy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(324761..326245)
Genome map
AA seq 494 aa AA seqDB search
MDRGRFLRAAGALALLPVLVRCGGERLPDYPFRLGVASGEPSPDGFVIWTRLAPDPLAPD
GLGGMPEDAEHAVRWEVSEDEGFRRVVRAGRAEARPELGHSVHVEVGGLRSGRWYWYRFE
AGGEVSPVGRARTLPAPGEAVGSLSFALASCQDWAGGDYPAYRRMAGEELDLVVHLGDYV
YEEEDTRTLADFRRLYGLYKSAPALREAHAAFPFVAVPDDHEVDNDWAGPYPEDYPELGR
EEFLRIRAAAFQAYYEHMPLRPSSLPRGPRMRLHRRLRFGGLAELHLLDTRQHRDDQPTG
RLIAPRRPEALEPGRSMLGEEQRRWLFSGLRRSRARWNLIAQQTMLARYDYDTGPGVSVN
HDQWDGYAAARRRLLGFLRERRPSGPVVLSGDWHAGFVNDLKADFRDPASQTVAPEIVTP
SISSGCPWADRVERALGENPHVKYFGGDRRGYVRCSLQEGLLRADFRLLEGPERMVTASS
WAVEAGSPEARRAF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgggcgtttcctgcgcgcggcgggggcgctcgcgctcctgcccgtgctcgtc
cgctgcggcggcgagcggctcccggactaccccttccggctcggggtggcctcgggagag
ccctcccccgacggcttcgtcatctggacccgcctcgccccggaccccctcgccccggac
ggccttgggggcatgccggaagacgcagagcacgcggtgcgctgggaggtttccgaggat
gagggcttccggagggtggtgagggcggggagggccgaggcgcggccggagcttgggcac
agcgtgcacgttgaggttgggggcttgaggtctgggaggtggtactggtacaggttcgag
gcgggaggggaggtgagccccgtgggcagggcgaggacgctgcccgctcccggggaggcg
gtggggagcctctccttcgcgctcgcctcctgccaggactgggcggggggagactacccg
gcctaccggcggatggcgggggaggagctggacctcgtcgtccacctcggcgactacgtc
tacgaggaggaggacacccgcacgctcgcggacttccgccgcctctacggcctgtacaag
agcgccccggcgctgcgcgaggcccacgccgccttccccttcgtcgccgtccccgacgac
cacgaggtggacaacgactgggcgggcccctacccggaggactacccggagctcgggcgg
gaggagttcctgcgcatcagggccgcggccttccaggcctactacgagcacatgcccctc
aggccctcctcgctgccgcgggggccgcgcatgcgcctgcacaggcgcctccggttcggc
ggcctcgccgagctacacctcctcgacacccgccagcaccgggacgaccagcccaccggc
cggctcatcgccccccgcaggccggaggcgctggagcccggccgctccatgctgggcgag
gagcagcggcgctggctcttctccggcctgcggcgctcgcgggcgcgctggaacctcatc
gcccagcagaccatgctcgcccgctacgactacgacaccgggccgggcgtgagcgtaaac
cacgaccagtgggacgggtacgcggcggcccgccggcggctgctcggcttcctgcgcgag
cggcggccctccggaccggtggtcctctccggcgactggcacgccgggttcgtcaacgac
ctcaaggccgacttccgcgaccccgcctcccagacggtggcccccgagatcgtcaccccc
tccatcagctcgggctgcccgtgggcggaccgggtggagcgggcgctgggcgagaacccg
cacgtcaagtacttcgggggcgaccggcgggggtacgtccgctgctctctccaggagggc
ctgctgcgggccgacttccggctcctggagggccccgagaggatggtcaccgcctcctcg
tgggccgtggaggccggaagccccgaggcccgcagggctttttaa

DBGET integrated database retrieval system