KEGG   Rubrobacter xylanophilus: Rxyl_0316Help
Entry
Rxyl_0316         CDS       T00368                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rxyl_0316
Enzymes [BR:rxy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rxyl_0316
Exosome [BR:rxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rxyl_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
336928..339096
Genome map
AA seq 722 aa AA seqDB search
MRREEAIRAVVAGDHPDPFSFLGPHEEAGRRVVRTFLPGAARVRVLSAAGRPLGELERVH
PEGFFSGPLSGNGRYRLRVLWEGGGEDELEDPYRFPPVLSDYDLYLFGEGNNHRIYRHLG
AHPAEMDGVCGTAFAVWAPNARRVSVVGDFNLWDGRRHPMRNRNGVWEIFLPGVGPGALY
KYEIKDAGGSLLPLKADPYGFFAEQYPGTASIVWDLSRHRWEDGEWMERRGSRNAPDAPM
AIYEVHLGSWRRRPDGSHLTYRELAEELVPYVAGLGYTHVELLPPMEHPFGGSWGYQPVG
LFAPTSRFGPPEDFKHLVDAFHRAGVGVIADWVPAHFPEDAHGLARFDGTHLYEHADPRK
GRHPDWGTLIYNYGRNEVRNFLISNALFWLDEYHIDGLRVDAVASMLYLDYSRKEGEWVP
NEHGGNENLEAIAFLRRMNEVVYGEAPGAFTVAEESTAWPMVSRPTYMGGLGFGYKWNMG
WMHDTLQYMKEDPVHRRYHHDRITFGLLYAFNENFILPLSHDEVVHGKGSLLGRMPGDRW
QRFANLRAYYGFMYGHPGKQLLFMGGEFAQEREWDSGSQLDWHLLEGGENRGVRDLVADL
NALYRATPALHQVDFEPEGFEWVEGGDAEQSVVSFLRRARNPEDFVLVVSNFTPVVRHGY
RVGVPASGPYAEVLNTDDPRYGGSGVANGELEAEEVPWHGRPFSLRLTLPPLATVFLRPR
PV
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagacgcgaagaggccatccgcgccgtggtcgccggcgaccaccccgaccccttctcc
tttctggggccgcacgaggaggcgggccggcgggtggtgaggaccttcctgcccggcgcg
gcgcgggtgcgggtgctctccgccgccggccggccgctgggagagctggagcgcgtccac
ccggaggggttcttctccggccccctctccggcaacggccgctaccggctgcgggtcctc
tgggagggcgggggggaggacgagctcgaggacccctaccggttcccgcccgtcctcagc
gactacgacctctacctcttcggcgaggggaacaaccaccgcatctaccggcacctcggg
gcccacccggcggagatggacggcgtctgcggcaccgccttcgccgtctgggcccccaac
gcccgcagggtctcggtcgtcggggacttcaacctctgggacggccggcggcaccccatg
cgcaaccgcaacggggtgtgggagatcttcttgcccggcgtggggcccggggccctctac
aagtacgagataaaggacgcgggcggctccctgcttccgctcaaggccgacccctacggc
ttcttcgccgagcagtacccgggcaccgcctccatcgtctgggatctctcccgccaccgg
tgggaggacggggagtggatggagcggcgggggagcaggaacgccccggatgcccccatg
gccatctacgaggttcacctgggctcctggcgccgccgcccggacggctcccacctcacc
taccgcgagctggccgaggagctcgtcccctacgtcgccgggctcggctacacccacgtc
gagctcctgccgcccatggagcaccccttcggaggctcgtggggctaccagcccgtgggg
ctcttcgcccccaccagccgcttcgggccgcccgaggacttcaagcacctggtggacgcc
ttccaccgggcgggcgtcggggtcatcgcggactgggtcccggcccacttccccgaggac
gcccacggcctcgcccgcttcgacggcacccacctctacgagcacgccgacccccgcaag
gggcgccacccggactggggcaccctcatctacaactacgggcgcaacgaggtgcgcaac
ttcctcatctccaacgccctcttctggctcgacgagtaccacatcgacggcctcagggtg
gacgccgtggcctccatgctctacctggactactcccggaaggagggcgagtgggtcccc
aacgagcacgggggcaacgagaacctggaggccatagcctttctgcggcggatgaacgag
gtggtctacggggaggcgccgggggccttcaccgtcgccgaggagtccaccgcctggccg
atggtctcccggcccacctacatgggggggctgggcttcggctacaagtggaacatgggc
tggatgcacgacaccctgcagtacatgaaggaggaccccgtccaccgccggtaccaccac
gacaggatcaccttcggcctcctctacgccttcaacgagaacttcatcctgccgctctcc
cacgacgaggtggtgcacggcaagggctcgctcctggggaggatgcccggcgaccggtgg
cagcgcttcgccaacctgcgcgcctactacggcttcatgtacggccaccccggcaagcag
ctgctcttcatgggcggggagttcgcccaggagcgggagtgggacagcggctcccagctg
gactggcacctgctggaggggggcgaaaaccggggcgtgcgcgacctcgtcgccgacctc
aacgccctctaccgcgccacccccgccctgcaccaggtggacttcgagccggagggcttc
gagtgggtggagggcggcgacgccgagcagagcgtggtctcttttctgcgccgcgcccgc
aacccggaggacttcgtgctcgtggtctccaacttcaccccggtcgtccggcacggctac
cgggtcggggtgcccgcctccggaccctacgccgaggtgctcaacaccgacgacccccgc
tacggcggcagcggggtggcaaacggcgagctcgaggccgaggaggtcccctggcacggc
aggcccttctccctccggctcaccctcccgccgctggccaccgtcttcctgcgcccccgc
ccggtgtag

DBGET integrated database retrieval system