KEGG   Rubrobacter xylanophilus: Rxyl_0350Help
Entry
Rxyl_0350         CDS       T00368                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rxyl_0350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_0350
   00020 Citrate cycle (TCA cycle)
    Rxyl_0350
   00620 Pyruvate metabolism
    Rxyl_0350
Enzymes [BR:rxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rxyl_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
375803..376993
Genome map
AA seq 396 aa AA seqDB search
MHKLHLPRLGQTMERGTILRWARREGEPFEVGDILYEVESEKAVNEIEAKLPGTLARITV
EEGQECPVGTLLAVVADPGETLSEEEIEAAIAEEGGREAPAASGGGTGVRAPSSARAQRR
VRAMPKARALARELGVELAAVEGTGQGGAITVEDVRRAAGAAPGEGPRVRERRPLGDVGR
TMARVVTRSWHEVPQFVQMVQLDASALVGRRRELAGQIKRSHGVDLSYTDLLLEAVAGAA
GEEPLANSSLVDGEILLYEDVNVSVAVATGSGLLVPVVRWAQALELGELAARLREVLERA
RSGRLSAEDTAGGTITLSNLGMYGIEGGTPLVTHPQAAVVFAGAIVERPWAVSGRVEVRP
TLTLSVGFDHRILDGVAAARFTTALRRRLESPNQEG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgcacaagcttcaccttccccggctcgggcagaccatggagcggggaaccatactacgc
tgggccaggcgcgagggggagcccttcgaggtgggggacatcctctacgaggtcgagtcg
gagaaggccgtcaacgagatcgaagccaagctacccggtacgctcgcccgcatcacggtc
gaggaggggcaggagtgcccggtggggacgctcctggcggtcgtggccgacccgggcgag
acgctctccgaggaagagatcgaggcggccatagccgaggagggcgggagggaggccccc
gcggcctccgggggcgggaccggggtccgggcgccgtcctccgcccgggcgcaaaggcgg
gtccgcgcgatgcccaaggcccgcgctctcgccagggagctgggcgtggagctagccgcg
gtagaaggaaccggccagggaggagcgataaccgtcgaggacgtccggcgggccgccggg
gctgcgccgggcgaggggccgagggtgagggagaggcgtccgctcggcgacgtcgggcgg
accatggcccgggttgtgacccgcagctggcacgaggtgccgcagttcgtgcagatggtg
cagctcgacgcaagcgcgctcgtggggcgcaggcgcgagctggcagggcagataaagcgt
tctcacggcgtggacctctcctacaccgacctgctcctcgaggccgtggccggcgccgcg
ggtgaggagccgctcgccaactcctccctggtggacggggagatcctcctctacgaggac
gtcaacgtctccgtggccgttgcgaccgggtccgggctgctcgtgcccgtggtaaggtgg
gcgcaggccttggagctcggagagctcgccgccaggctacgcgaggttctcgagcgcgcg
cgcagtggtcgtctctcggctgaggataccgcggggggcaccataacgctctccaacctc
ggcatgtacgggatagaaggcggcacgcccctggtcacccacccgcaggccgcggtggtt
ttcgccggggccatcgtcgagcgtccctgggccgtctccgggcgggtcgaggtccgcccg
accctcacgctctctgtcgggttcgaccacaggatcctcgacggcgtcgcggccgcgcgc
ttcaccaccgcgctgagaagaaggctggagagcccaaaccaggagggctag

DBGET integrated database retrieval system