KEGG   Rubrobacter xylanophilus: Rxyl_0401Help
Entry
Rxyl_0401         CDS       T00368                                 

Definition
xylose isomerase-like protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rxy00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rxy00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
430304..431368
Genome map
AA seq 354 aa AA seqDB search
MKNSVGIWAFGPAVTRFVPPGYHPEAAEEPMAEKTKRVCEGLSDVLDGIEYHYPGEINEE
NADEITEILESHRMDLPVVAAGLHTDPTYALGAFINPDPSLRRKGIDTLKRGIDLAAEVG
ANFIIWPGAEGYNYPFQRPYAETWRAFVEAVAELAEHASGRGIKVFLEHKNSEPAMQILM
KNIGMTLFVIHKVEELGVDTRNLLVNMDWQHLIMNGENLAEYAALLSAENRLGHQHANDG
WGTFDDDNVVGTNFFMQTLELCHTLREIGYGEGGERMGFDLYPYTEDQVAAVRRAILHLE
FIWELAGRIDGAVLAEARERADALGAQKAVYGALGLDEEFERRVVRARREERGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaactccgtggggatctgggcgtttgggccggcggtgacccgcttcgtccccccc
ggctaccaccccgaggccgcagaggagccgatggccgagaagacaaagcgggtgtgcgag
ggcctctccgatgtcctcgacggcatcgagtaccactaccccggcgagataaacgaggag
aacgcagacgagatcacggagatcctcgagagccaccgcatggatctgcccgtggtggcc
gcggggctgcacaccgaccccacctacgccctgggcgcgttcataaaccccgacccctcg
ctgcgccgcaaggggatagacaccctcaaacgcgggatagacctggccgcggaggtgggg
gcgaacttcatcatctggcccggcgccgaaggatacaactaccccttccagcggccctac
gccgagacctggcgggcgtttgtcgaggccgtcgccgagcttgccgagcacgcgagcggc
cggggcataaaggtcttcctcgagcacaaaaacagcgagccggcgatgcagatcctgatg
aagaacatcgggatgacgctctttgtgatccacaaggtggaggagctcggggtggacacc
cggaaccttctcgtcaacatggactggcagcacctgatcatgaacggcgagaacctcgcc
gagtacgcggcgctgctctctgccgagaacaggctcggccaccagcacgccaacgacggc
tggggcaccttcgacgacgacaacgtggtcggcaccaacttcttcatgcagaccctcgag
ctctgccacaccctgcgggagatcggctacggagagggcggggagcggatgggcttcgac
ctctatccctacacggaggaccaggtggccgcggtgcggcgcgccatcctgcacctggag
ttcatctgggagctcgccgggaggatagacggcgcggtgctcgccgaggccagagagagg
gccgacgcgctcggggcccagaaggccgtctacggcgccctgggcctcgacgaggagttc
gagcggcgggtggtgcgcgcccgcagagaggagcgcgggggatga

DBGET integrated database retrieval system