KEGG   Rubrobacter xylanophilus: Rxyl_0510Help
Entry
Rxyl_0510         CDS       T00368                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rxy  Rubrobacter xylanophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rxyl_0510
DNA repair and recombination proteins [BR:rxy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rxyl_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
544081..544680
Genome map
AA seq 199 aa AA seqDB search
MATYARSVERLIAELSRLPTIGPRSAQRIAFHIIRTRKEEALALAEALREVKERIRPCRR
CFNLTEGEECDICRDPRRDRSVICVVEDPYDIGPIERTGEYRGLYHVLGGALSPLDGVEP
EDLRIAELVERVRSEGTRELILATNPNTTGEATAMFIAQEVRELPVRVTALASGLPVGGD
LEYADEVTLGRAFAGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacctacgcgcggtccgtagagcgcctcatcgccgagctctccaggctccccacc
atcgggccccgcagcgcccagcggatagccttccacatcatccgcaccagaaaggaggag
gcgctggcgctggccgaggcgctgcgggaggtcaaggagcggatacgcccctgccgacgc
tgcttcaacctcaccgagggggaggagtgcgacatctgccgggacccgcggcgggaccgg
agcgtgatctgcgtggtggaggacccctacgacatcgggcccatagagcgcaccggggag
taccgggggctctaccacgtgctcgggggggcgctctcccccctcgacggggtggagccg
gaggacctgcgcatagccgagctggtggagcgggtcaggagcgaggggacccgggagctg
atcctggccaccaaccccaacaccaccggggaggccacggcgatgttcatcgcgcaggag
gtacgggagctcccggtgcgggtgacggcgctggcgagcgggctgccggtggggggcgac
ctggagtacgccgatgaggtcaccctgggccgggccttcgccgggcggcgtgagctctag

DBGET integrated database retrieval system