KEGG   Rubrobacter xylanophilus: Rxyl_0629Help
Entry
Rxyl_0629         CDS       T00368                                 

Definition
glycosyl hydrolase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rxy  Rubrobacter xylanophilus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rxyl_0629
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Rxyl_0629
Enzymes [BR:rxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rxyl_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(660405..662219)
Genome map
AA seq 604 aa AA seqDB search
MGMGRLRCVVLGVMLLVLGAAGTGAARPGEECGRHVVERVLHRMSLEEKVGQMFVTYAYG
DSAEDTDPEMVAANREAHGVDDFRQLIERYHLGGIIYFAWSGNVENPRQIAGLSNGLQRA
ALGSGAGVPLLISTDQEQGVVVRVDYPATQFPGSIALGAGRGEEDARTAAEITGEELRAI
GINQNFAPVADVNVNPRNPVIGVRSFGEDPRLVARLTAAQVEGYQEGAGVAATAKHFPGH
GDTDVDSHYGLPVINHSREELAEVDLPPFEAAIRSGVDAIMTAHIVVPALDGSGRPATLS
KPILTGLLRREMGFDGVIVTDSLGMAGVRQQFGDERVPVEAIKAGADMLLMPPDIDLAYN
AVLEAVRSGEIKRRRIDASVRRILALKLERGLFEDPFVNEERVDEVVGTPEHHAAAAEIS
DRTITLVKNEAGLLPLEPDTGRKVLVTGAGGYAGSAADQGDRSTLGSLAAAMEGFGVETE
VYETGTDPDASRRSAAVAKAQNSDLVVVTTNKAWTSEGQQRLVKELLATGRPVIVAAVRD
PYDIAYFTEAETYLATYSYKPVSMEALARVLFGAVNPTGRLPVTIPTAEDPNAALYPYGH
GLSY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgggccggctgcgctgcgtggtgttgggggtcatgctgctggtgctgggcgcg
gcggggacgggggctgcgcggcccggggaggagtgcgggcggcacgtggtggagcgggtc
ttgcaccgcatgtcgctggaggagaaggtcgggcagatgttcgtcacctacgcctacggg
gacagcgcggaggatacggacccggagatggtggcggccaacagggaggcccacggggtg
gacgacttccgccagctcatcgagcgctaccacctcggcgggataatctacttcgcctgg
tcgggcaacgtcgagaacccgcggcagatagccgggctctccaacggcctccagcgggcc
gccctggggagcggggcgggcgttccgctgctcatctccaccgaccaggagcagggcgtg
gtggtgcgggtggactacccggcgacccagttccccggcagcatagccctcggggcgggg
cgcggcgaggaggacgcccgcaccgcggcggagatcaccggggaggagctgcgggcgatc
gggataaaccagaacttcgccccggtcgccgacgtcaacgtcaaccccagaaacccggtg
atcggggtgcgctccttcggggaggacccgcggctcgtcgcgcggctgacggcggcgcag
gtcgagggctaccaggagggggctggcgtcgccgccaccgccaagcacttcccgggccac
ggggacaccgacgtggacagccactacgggctgcccgtcatcaaccacagccgggaggag
ctcgccgaggtggacctcccgcccttcgaggccgccatccggtccggggtggacgccata
atgaccgcccacatcgtcgtcccggcgctcgacggctccgggcgcccggcgacgctctcc
aagcccatcctgaccggcctgctgcgcagggagatgggcttcgacggcgtgatcgtcacc
gactccctggggatggccggggtgcgccagcagttcggcgacgagcgggtccccgtggag
gccataaaggccggggcggacatgctgctcatgccgcccgacatagacctcgcctacaac
gccgtgctcgaggcggtgcggagcggcgagataaagcggcgcaggatagacgcctccgtc
cgccgcatcctcgcgctcaagctcgagcgcggcctcttcgaggaccccttcgtaaacgag
gagagggtggacgaggtcgtcggcacccccgaacaccacgccgcggccgcggagatctcc
gaccgcaccatcaccctggtaaagaacgaggcgggcctgctgccgctggagcccgacacc
gggcggaaggtgctcgtcaccggggcgggcggctacgccgggagcgccgccgaccagggc
gaccgcagcacgctcggcagcctggccgccgccatggagggcttcggcgtcgagacggag
gtctacgagaccggcaccgacccggacgcctccaggaggagcgcggccgtcgccaaggct
caaaatagcgacctggtcgtcgtcaccaccaacaaggcgtggacttccgagggccagcag
cggctcgtgaaggagctgctcgccaccggcaggcccgtcatcgtggcggccgtgcgcgac
ccctacgacatagcgtacttcaccgaggcggagacctacctggccacctacagctacaag
cccgtctcgatggaggcgctggcgcgggtgctctttggcgcggtgaacccgaccggcagg
ctcccggtcaccatcccgaccgccgaagacccgaacgccgcgctctacccctacgggcac
gggctgagctactga

DBGET integrated database retrieval system