KEGG   Rubrobacter xylanophilus: Rxyl_0738Help
Entry
Rxyl_0738         CDS       T00368                                 

Definition
(GenBank) peptidase M42
Organism
rxy  Rubrobacter xylanophilus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
768120..769181
Genome map
AA seq 353 aa AA seqDB search
MRKESYDFLKRLLSAPGPSGREEAAARVWREEAGRFADGVRGDRMGNSFATLNPGGRPRV
MLSGHIDEIGLIVTHVDEQGFVRFKGVGGWDPQVLVGQRVRLRTGSGEIPGVIGKKAIHL
MESEERKKASEIKGLWIDIGARDAEEARRSVRVGDVAVLDQEPVELPNGRLASRSLDNRM
GAFVVLEALRLLSEEEGLSAEVVAVATVQEEVGIYGARGAAFGLDPDAAIAVDVTHATDT
PGVPKNEHGDHPLGSGPVIARASVLSPLVTDGLVSAAEREGIPYTLEADSSRTGTDADAI
HLSRAGIATGLVSCPNRYMHSPNEMVELGDLEGCARLIASYVRSLGPDADFVR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaagagtcctacgatttcctgaagaggctcctctccgcgccgggaccgagcggc
cgcgaggaggccgccgcgcgggtgtggcgggaggaggccgggcgtttcgccgacggggtg
cgcggcgacaggatgggcaactccttcgccacgctcaaccccggcggccgcccgcgggtg
atgctcagcgggcacatagacgagatcgggctgatcgtcacccacgtggacgagcagggg
ttcgtccgcttcaagggcgtcgggggctgggacccgcaggtgctggtgggccagcgggtg
cgcctccggaccgggagcggcgagatccccggcgtcatcggcaagaaggccatccacctc
atggagagcgaggagcgcaaaaaggcctccgagataaagggcctgtggatagacatcggg
gcgagggacgccgaggaggcgcgccggagcgtgcgcgtgggggatgtggctgtcctcgac
caggagccggtggagcttcccaacgggcgcctcgcctcccgctcgctggacaaccggatg
ggggccttcgtcgtgctggaggcgctgcggctgctctccgaggaggaggggctctccgcc
gaggtggtggcggtcgccaccgtgcaggaggaggtcggcatctacggcgcccgtggcgcc
gccttcgggctggacccggacgcggccatcgccgtcgacgtcacccacgccaccgacacc
cccggggtgcccaagaacgagcacggggaccacccgctcggcagcggccccgtcatagcc
cgggcctccgtgctcagcccgctggttacggacggcctcgtctccgccgccgagcgcgag
ggcatcccctacaccctggaggccgactcctcccgcaccggcacggacgccgacgccatc
cacctctcgcgggcggggatcgccaccgggctcgtctcctgccccaaccgctacatgcac
tcgccgaacgagatggtggagctgggagatctggaggggtgcgcccggctcatcgcctcc
tacgtgcgctcgctgggccccgacgcggacttcgtccggtag

DBGET integrated database retrieval system