KEGG   Rubrobacter xylanophilus: Rxyl_0832Help
Entry
Rxyl_0832         CDS       T00368                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rxyl_0832
Enzymes [BR:rxy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Rxyl_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
867803..869236
Genome map
AA seq 477 aa AA seqDB search
MARIGILTMSDGRGFVHRDVEGFCRKSEERLASALREAGHEVVRAREVVWTNRLAVSEAR
RVADARPDLTVFNIPVWAFPHFSLLAAAETPGPLLLFSNVDPQYPGMVGMLAAAGGLDQV
GRTYGRAWGDVSEPAVLARLEAHARAARAANGLRGSTFGRIGGRPMGMYTAVSNPDQWMQ
KFGVDVEEIDQWELVRRSEGVEAGKVRRAREWLEEHAAGVHYDGRQLTPELLERQIRSYY
AMRELIEEWNLDFSGIKAQPELTTHFCTMDVTEAFLNDPYDWDGEKEVHVCATEADMDAA
LTMQILKGISETPVLFADVRHHHADRDIWDLVNSGQHATWFAERSDDPAENLRRVHLYPE
GFYFPAGGASVHHLAAPGEFTFARLTRKGGRYRMHVLKGSFERYDEATNEELMRQSTYEW
PHAFARFEAAADEVLSRYGSNHIHAVPGDRVQELRAVCELLDIDYDGFGSAGGGEKR
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaggataggcatcctgaccatgtccgacgggcgcggcttcgtccaccgggacgtg
gaggggttctgcaggaagagcgaggagcggctcgcctcggccttgagagaggccggtcac
gaggtcgtgcgcgcccgcgaggtcgtctggacgaaccggctcgccgtgagcgaggcgcgg
cgcgtcgccgacgcgaggccggacctgacggtcttcaacatccccgtgtgggccttcccg
cacttctcgttgctcgccgccgcggagacgcctgggccgctcctcctgttctccaacgtg
gacccgcagtaccccggcatggtcgggatgctcgcggcggcgggcgggctcgaccaggtc
gggcgcacctacggccgcgcctggggagatgtctccgagcccgcggtgctcgcgaggctg
gaggcgcacgcgcgggcggcgcgcgcggcaaacggtcttcgcgggagcaccttcgggagg
ataggcgggaggcccatgggcatgtacaccgccgtctccaaccccgaccagtggatgcag
aagttcggcgtggacgtcgaggagatcgaccagtgggagctcgtgcgccgctcggagggg
gtggaggccgggaaggtccgcagggcgcgcgagtggctcgaggagcacgccgcgggcgtc
cactacgacggaaggcagctcacgcccgagctcctggagcgccagatccgctcctactac
gcgatgcgcgagctgatagaggagtggaacctcgacttctccggcataaaggcccagccc
gagctcaccacccacttctgcaccatggacgtgaccgaggccttcctcaacgacccctac
gactgggacggcgagaaggaggtgcacgtctgcgccaccgaggcggacatggacgccgcc
ctcaccatgcagatcctcaagggcataagcgagacgcccgtgctcttcgccgacgtcagg
caccaccacgccgaccgggacatctgggacctcgtgaactccggccagcacgccacctgg
ttcgccgagaggagcgacgacccggcggagaacctgcggcgcgtccacctctaccccgag
ggcttctacttccccgctggaggggcgagcgtgcaccacctcgcggcgcccggcgagttc
accttcgcccgcctcacccgcaagggcgggcgctaccggatgcacgtgctgaagggctcc
ttcgagcgctacgacgaggcgacgaacgaggagctcatgcgccagtccacctacgagtgg
ccccacgccttcgcccgcttcgaggccgccgcggacgaggtgctctcccgctacggctcg
aaccacatccacgccgtacccggcgaccgcgtccaggagctgcgcgccgtctgcgagctc
ctggacatcgactacgacgggttcggctccgccgggggcggggagaagagatga

DBGET integrated database retrieval system