KEGG   Rubrobacter xylanophilus: Rxyl_0889Help
Entry
Rxyl_0889         CDS       T00368                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rxyl_0889
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_0889
   00052 Galactose metabolism
    Rxyl_0889
   00500 Starch and sucrose metabolism
    Rxyl_0889
   00520 Amino sugar and nucleotide sugar metabolism
    Rxyl_0889
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rxyl_0889
   00524 Butirosin and neomycin biosynthesis
    Rxyl_0889
Enzymes [BR:rxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rxyl_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
929980..930939
Genome map
AA seq 319 aa AA seqDB search
MNAIGVDVGGTKIAAGVVTPQGKILKEVRYPSSGPPEVLLGNIVRAVREVGRGVDGVAAV
CLAVPGLLVSSEDRVAFSPNLRTIENIPLREALEPEIGLPLTVENDANAAAWGEFRFGAG
SEVDHLLCVTLGTGVGGGVISHGVLLRGAQGAGGELGHVTVHATGPRCACGNRGCLEAMC
SGTAIARYARVVAAKRPDSALGRLAVRRRIIGEDVTELARRGDRAALSVLEEAGTWLGIG
LAGFVNVFNPEVVAVGGAVSVAGELILAPARREIALRARPPSRDLVRVKEATLGPESGVL
GAAALARDPESGEYVFGPG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatcggcgtggacgtgggggggaccaagatcgccgcgggcgtcgtgaccccc
cagggcaagatactcaaggaggtgcgctacccctcctccgggccgccggaggtgctcctg
ggcaacatcgtccgggcggtgcgggaggtgggaaggggcgtcgacggggtcgcggccgtc
tgcctggcggtgcccggcttgctggtctcctcggaggacagggtggccttctccccgaac
ctgcgcaccatcgagaacatccccctcagggaggcgctggagccggagatagggctgccg
ctcaccgtggagaacgacgccaacgccgccgcgtggggggagttccggttcggggcgggc
agcgaggtggaccacctcttgtgcgtcacgctgggcaccggggtggggggcggtgtgatc
tcgcacggcgtcctgctgcgcggcgcccagggggcgggcggggagctggggcacgtgacg
gtccacgccacggggccccgctgcgcctgcggcaaccgggggtgcctcgaggcgatgtgc
tccgggacggccatagcccgctacgcccgggtggtcgcggcgaagcggccggactcggcc
ctggggcggctcgccgtccggcgcaggataatcggggaggacgtcaccgagctggcccgc
cggggcgaccgggcggcgctctcggtgctggaggaggcggggacctggctgggcatcggg
ctcgcgggcttcgtgaacgtcttcaacccggaggtggtggccgtgggcggggcggtctcc
gtcgccggggagctgatcctggcccccgcccgccgcgagatagccctccgggcgcgcccc
ccctcgcgcgacctggtgcgggtgaaggaggccaccctgggccccgagtccggggtgctg
ggggccgccgctctcgcccgggacccggagagcggggagtacgtcttcggtccggggtag

DBGET integrated database retrieval system