KEGG   Rubrobacter xylanophilus: Rxyl_0920Help
Entry
Rxyl_0920         CDS       T00368                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rxyl_0920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_0920
   00020 Citrate cycle (TCA cycle)
    Rxyl_0920
   00620 Pyruvate metabolism
    Rxyl_0920
   00640 Propanoate metabolism
    Rxyl_0920
   00650 Butanoate metabolism
    Rxyl_0920
  Energy metabolism
   00680 Methane metabolism
    Rxyl_0920
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rxyl_0920
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rxyl_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
958379..959593
Genome map
AA seq 404 aa AA seqDB search
MTIEKPVGRQTEKLTTGTQAVAQAVKLADVDVTAAYPIRPYDGVMQAVAKLIADGELDCE
FIVAEGEHSQFEICKHASAVGSRVFVGSSGVGWMYAMESLCVTPSLRLPVVAMIGNRALD
DPGAFGVEHNDAMAVRDLGWLLFWVEDAQECFDATLMAYRVGEDPRVSLPVGLGVDGAFI
THSQTLIKIPDQETVNEFLPPYDLGDRLLHPDNPISIAPQANEDWVMEIRKQTDAAARRV
KDVIREAHADFRRLFGRGGDNPFFEEYMTEDAEYVLFGMGSLGLPAKVMVRRLRERGEKV
GFVRLKWFRPFPAEELAESLGRFRAVGVIDRDYSYGSPQQGGVLFTDLRAALYDAERRPR
IVNFIGGLGGRELTPEMMDEMADLTKRAGRGEDVPAVSWIGVRE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagagaagccggtagggcggcagaccgagaagctgaccaccggcacccaggcg
gtggcccaggcggtgaagctggccgacgtcgacgtgacggcggcctaccccataaggccc
tacgacggcgtcatgcaggcggtggccaagctcatcgccgacggggagctcgactgcgag
ttcatcgtcgccgagggcgagcactcgcagttcgagatctgcaagcacgcctccgccgtg
ggcagccgggtgttcgtgggctcctcgggcgtgggctggatgtacgcgatggagtcgctg
tgcgtgacgccttcgctgcggctgccggtggtcgccatgatcggcaaccgggcgctcgac
gacccgggggccttcggggtcgagcacaacgacgcgatggccgtgcgggatctgggctgg
ctgctcttctgggtggaggacgcccaggagtgcttcgacgccacgctcatggcctaccgg
gtcggcgaggacccgcgggtctcgctgccggtggggctcggggtcgacggggcgttcatc
acccactcccagacgctcatcaagatccccgaccaggagaccgtgaacgagttcctcccg
ccctacgacctcggggaccggctgctgcacccggacaaccccatcagcatcgccccccag
gccaacgaggactgggtgatggagatccgcaagcagaccgacgcggccgcccgcagggtg
aaggacgtgatccgggaggcccacgcggacttccggcggctgttcgggcgcgggggcgac
aaccccttcttcgaggagtacatgaccgaggacgccgagtacgtgctcttcggcatgggc
tcgctggggctcccggccaaggtcatggtccggcgcctgcgggagaggggggagaaggtc
gggttcgtgcgcctgaagtggttcaggcccttccccgccgaggagctcgccgagtcgctc
ggccgcttccgggcggtcggcgtgatcgaccgggactactcctacggctcgccgcagcag
ggcggggtgctcttcaccgacctccgggccgccctctacgacgccgagcggcggccgagg
atagtgaacttcatcggcgggctcggcggccgggagctcacccccgagatgatggacgag
atggccgacctcaccaagcgggccgggcgcggggaggacgtgccggccgtcagctggatc
ggcgtgcgcgagtga

DBGET integrated database retrieval system