KEGG   Rubrobacter xylanophilus: Rxyl_0921Help
Entry
Rxyl_0921         CDS       T00368                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rxy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rxy00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rxy00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rxy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rxy00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rxy00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:rxy00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:rxy00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
959618..960808
Genome map
AA seq 396 aa AA seqDB search
MTVEAPGRALKLEPIRSIKKAPVEEFYQSGHRTCQGCLSALPMRLMAKAAGPRTIVLGTT
GCMYVANTTYMTTPWVVPWMHTQLGAAGSAAVGTSAGLKALMRKGKMKDEPINVIAFCGD
GGGADMGLSAISAALTDIEYNLLIFLYDNESYANTDIQTSGQTPWGAVTTFSPPGKKFRI
MQRRWKKNVPGMLAAGHPDTRYVASGTPAIPVDMMDKVRAALRAGGPTYIHVLDPCPKGW
HYDPEHSNELGKLAIETGIYPLYEVKDGVLNFTGITKQIAEGRRRRKPVREYLEKQGRFA
HFKNQDYAYFQKKVDEMWEQWIIPCVVAFSYGGPINITGDIPKVRNRNVKRENASWAGEP
GHSHEEFAETPDEPQEPWRDDNELGRYPWALPSTGQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgaggcaccgggacgggcgctcaagctcgagcccatccggtccataaagaag
gccccggtggaggagttctaccagtccgggcaccggacctgccagggctgcctctcggcg
ctcccgatgaggctcatggccaaggcggccggcccccggaccatcgtgctggggaccacc
gggtgcatgtacgtggccaacaccacctacatgaccaccccctgggtggtgccgtggatg
cacacccagctcggggccgcaggctccgcggcggtcgggacctcggccgggctcaaggcg
ctcatgcgcaaggggaagatgaaggacgagccgataaacgtcatcgccttctgcggcgac
ggcggcggggcggacatggggctctcggccatcagcgccgccctcacggacatcgagtac
aacctcctgatcttcctctacgacaacgagtcctacgccaacaccgacatccagacctcg
ggccagacgccctggggcgccgtgaccaccttcagcccgccggggaagaagttccgcatc
atgcagcgccggtggaagaagaacgtccccggcatgctggccgccggccacccggatacc
aggtacgtggcctcgggcaccccggcgataccggtggacatgatggacaaggtccgggcg
gcgctgcgcgcgggcgggccgacctacatccacgtcctcgacccctgcccgaagggctgg
cactacgaccccgagcactccaacgagctgggcaagctggccatcgagacggggatctac
ccgctctacgaggtgaaggacggggtcctgaacttcaccgggatcaccaagcagatcgcc
gaggggcgccgccggagaaagccggtgcgggagtacctggagaagcaggggcgcttcgcc
cacttcaagaaccaggactacgcctacttccagaagaaggtcgacgagatgtgggagcag
tggatcatcccctgcgtcgtggccttcagctacggcggcccgatcaacatcaccggcgat
ataccgaaggtgcgcaaccgcaacgtgaagcgggagaacgcctcgtgggccggcgagccg
ggacacagccacgaggagttcgccgagaccccggacgagccgcaggagccctggcgcgac
gacaacgagctcggccgctacccctgggccctgccctccaccgggcagtaa

DBGET integrated database retrieval system