KEGG   Rubrobacter xylanophilus: Rxyl_0921Help
Entry
Rxyl_0921         CDS       T00368                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00010  Glycolysis / Gluconeogenesis
rxy00020  Citrate cycle (TCA cycle)
rxy00620  Pyruvate metabolism
rxy00640  Propanoate metabolism
rxy00650  Butanoate metabolism
rxy00680  Methane metabolism
rxy01100  Metabolic pathways
rxy01120  Microbial metabolism in diverse environments
rxy01130  Biosynthesis of antibiotics
rxy01200  Carbon metabolism
Module
rxy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_0921
   00020 Citrate cycle (TCA cycle)
    Rxyl_0921
   00620 Pyruvate metabolism
    Rxyl_0921
   00640 Propanoate metabolism
    Rxyl_0921
   00650 Butanoate metabolism
    Rxyl_0921
  Energy metabolism
   00680 Methane metabolism
    Rxyl_0921
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rxyl_0921
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rxyl_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABG03888
JGI: Rxyl0921
UniProt: Q1AXJ0
Position
959618..960808
Genome map
AA seq 396 aa AA seqDB search
MTVEAPGRALKLEPIRSIKKAPVEEFYQSGHRTCQGCLSALPMRLMAKAAGPRTIVLGTT
GCMYVANTTYMTTPWVVPWMHTQLGAAGSAAVGTSAGLKALMRKGKMKDEPINVIAFCGD
GGGADMGLSAISAALTDIEYNLLIFLYDNESYANTDIQTSGQTPWGAVTTFSPPGKKFRI
MQRRWKKNVPGMLAAGHPDTRYVASGTPAIPVDMMDKVRAALRAGGPTYIHVLDPCPKGW
HYDPEHSNELGKLAIETGIYPLYEVKDGVLNFTGITKQIAEGRRRRKPVREYLEKQGRFA
HFKNQDYAYFQKKVDEMWEQWIIPCVVAFSYGGPINITGDIPKVRNRNVKRENASWAGEP
GHSHEEFAETPDEPQEPWRDDNELGRYPWALPSTGQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgaggcaccgggacgggcgctcaagctcgagcccatccggtccataaagaag
gccccggtggaggagttctaccagtccgggcaccggacctgccagggctgcctctcggcg
ctcccgatgaggctcatggccaaggcggccggcccccggaccatcgtgctggggaccacc
gggtgcatgtacgtggccaacaccacctacatgaccaccccctgggtggtgccgtggatg
cacacccagctcggggccgcaggctccgcggcggtcgggacctcggccgggctcaaggcg
ctcatgcgcaaggggaagatgaaggacgagccgataaacgtcatcgccttctgcggcgac
ggcggcggggcggacatggggctctcggccatcagcgccgccctcacggacatcgagtac
aacctcctgatcttcctctacgacaacgagtcctacgccaacaccgacatccagacctcg
ggccagacgccctggggcgccgtgaccaccttcagcccgccggggaagaagttccgcatc
atgcagcgccggtggaagaagaacgtccccggcatgctggccgccggccacccggatacc
aggtacgtggcctcgggcaccccggcgataccggtggacatgatggacaaggtccgggcg
gcgctgcgcgcgggcgggccgacctacatccacgtcctcgacccctgcccgaagggctgg
cactacgaccccgagcactccaacgagctgggcaagctggccatcgagacggggatctac
ccgctctacgaggtgaaggacggggtcctgaacttcaccgggatcaccaagcagatcgcc
gaggggcgccgccggagaaagccggtgcgggagtacctggagaagcaggggcgcttcgcc
cacttcaagaaccaggactacgcctacttccagaagaaggtcgacgagatgtgggagcag
tggatcatcccctgcgtcgtggccttcagctacggcggcccgatcaacatcaccggcgat
ataccgaaggtgcgcaaccgcaacgtgaagcgggagaacgcctcgtgggccggcgagccg
ggacacagccacgaggagttcgccgagaccccggacgagccgcaggagccctggcgcgac
gacaacgagctcggccgctacccctgggccctgccctccaccgggcagtaa

DBGET integrated database retrieval system