KEGG   Rubrobacter xylanophilus: Rxyl_0949Help
Entry
Rxyl_0949         CDS       T00368                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rxyl_0949
Enzymes [BR:rxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Rxyl_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
987887..988792
Genome map
AA seq 301 aa AA seqDB search
MAGVFVMGSINQDFVLRVERRPGPGETVTDAELSLHPGGKGANQSAAAALLGAEVAFLGR
VGDDGLGEPLVRNLREKGVDAGLVERVAGRSTGAAFITVTPDGENAITVAPGANRALLPP
DVEAARERIAASRVLVAQMEIPRETVFRGVEVASEAGTRVLLNLAPPFEVPGELLGLLDP
LVVNEHEAAFLLGEPVEGVEGALAAAPELLGLGARSAVITLGPAGAVFALEGRAEHASAP
RVRAVDTTGAGDAFVGALAARLAAGEALGEAVAYAVRAGAAAVTREGAQGALPTPEVVEG
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggccggggtcttcgtgatgggctccatcaaccaggacttcgtcctgagggtggagcgg
cgcccgggcccgggcgagacggtcaccgacgcggagctctcgctgcacccgggcggcaag
ggggcgaaccagtcggcggcggcggcgctgctgggggcggaggtggcctttctgggcagg
gtcggcgatgacgggctgggggagccgctggtgcgcaacctgcgggagaagggggtggat
gcgggcctggtggagcgcgtcgcggggcgctccaccggcgcggcgttcataacggtcacc
ccggacggggagaacgcgatcacggtggcgccgggtgcgaaccgggcgctcctccccccg
gacgtggaggcggcccgcgagcggatcgccgcctcccgggtgctggtggcgcagatggag
atcccgcgggagacggtgttccggggggtggaggtggcgtcggaggcgggcacccgggtg
ctgctgaacctggccccgccgttcgaggtgccgggggagctcctggggctgctggacccg
ctggtggtgaacgagcacgaggcggccttcctgctcggggagccggtggagggggtggag
ggggcgctcgccgccgcgccggagctcctcggcctgggggcgcgctccgccgtgatcacg
ctcggccccgccggggcggtcttcgccctggagggccgggcggagcacgcgtccgccccc
cgggtgagggcggtggacaccacgggggccggggacgccttcgtcggggcgctggccgcc
cggctggccgccggggaggcgctgggggaggccgtcgcctacgcggtccgggccggggcg
gcggcggtcacgagagagggggcgcagggcgccctcccgacgccggaggtggtggagggg
ctgtga

DBGET integrated database retrieval system