KEGG   Rubrobacter xylanophilus: Rxyl_0961Help
Entry
Rxyl_0961         CDS       T00368                                 

Definition
coenzyme F420-0 gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:rxy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
998931..999665
Genome map
AA seq 244 aa AA seqDB search
MEILPVEGLPEVRPGDDLAALLLASAGEDLAPGDVLVVTHKVVSKAEGRLVDLREVRPSP
LAKSFAARHGKDPRHVEVVLRESRRIVRMERGLIISETHHGFVCANAGVDASNVPGEETV
CLLPLDPDASAARLARDVRERAGLELPVVISDSFGRPWRNGIANVAIGLCGMSPFADYRG
QRDPHGRTLEASVLAVADELAAAAELVMGKTSAVPAAVVRNYPYHPGPGTAKDLLMEPEK
DLFR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcctgccggtcgagggactccccgaggtgcgccccggggacgacctcgccgcc
ctgcttctggcctccgccggggaagacctcgcccccggcgacgtgctggtggttacgcac
aaggtcgtgagcaaggccgagggccgcctggtggacctccgggaggtgaggccctccccg
ctcgccaagtccttcgccgcccgccacgggaaggacccccgccacgtggaggtcgtgctg
cgcgagagccgccgcatcgtgcggatggagcgcggcctgatcatctcggagacccatcac
ggcttcgtgtgcgccaacgccggcgtcgacgcctccaacgtccccggcgaggagaccgtc
tgcctgctcccgctcgacccggacgcctccgccgcccgcctcgcccgggatgtgcgcgag
cgcgccggcctcgagctccccgtcgtcatctccgactccttcggccgcccctggagaaac
gggatcgccaacgtggccatcgggctctgcggcatgagccccttcgccgactaccgcggc
cagagagacccccacggccgcaccctcgaggccagcgtgctcgccgtggccgacgagctc
gccgccgcggccgagctcgtcatggggaagacctccgcggtgccggccgccgtggtgcgc
aactacccttaccaccccggccccgggaccgcgaaagacctcctcatggagcccgagaaa
gacctgttccggtaa

DBGET integrated database retrieval system