KEGG   Rubrobacter xylanophilus: Rxyl_0961Help
Entry
Rxyl_0961         CDS       T00368                                 

Definition
coenzyme F420-0 gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Rxyl_0961
Enzymes [BR:rxy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Rxyl_0961
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Rxyl_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
998931..999665
Genome map
AA seq 244 aa AA seqDB search
MEILPVEGLPEVRPGDDLAALLLASAGEDLAPGDVLVVTHKVVSKAEGRLVDLREVRPSP
LAKSFAARHGKDPRHVEVVLRESRRIVRMERGLIISETHHGFVCANAGVDASNVPGEETV
CLLPLDPDASAARLARDVRERAGLELPVVISDSFGRPWRNGIANVAIGLCGMSPFADYRG
QRDPHGRTLEASVLAVADELAAAAELVMGKTSAVPAAVVRNYPYHPGPGTAKDLLMEPEK
DLFR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcctgccggtcgagggactccccgaggtgcgccccggggacgacctcgccgcc
ctgcttctggcctccgccggggaagacctcgcccccggcgacgtgctggtggttacgcac
aaggtcgtgagcaaggccgagggccgcctggtggacctccgggaggtgaggccctccccg
ctcgccaagtccttcgccgcccgccacgggaaggacccccgccacgtggaggtcgtgctg
cgcgagagccgccgcatcgtgcggatggagcgcggcctgatcatctcggagacccatcac
ggcttcgtgtgcgccaacgccggcgtcgacgcctccaacgtccccggcgaggagaccgtc
tgcctgctcccgctcgacccggacgcctccgccgcccgcctcgcccgggatgtgcgcgag
cgcgccggcctcgagctccccgtcgtcatctccgactccttcggccgcccctggagaaac
gggatcgccaacgtggccatcgggctctgcggcatgagccccttcgccgactaccgcggc
cagagagacccccacggccgcaccctcgaggccagcgtgctcgccgtggccgacgagctc
gccgccgcggccgagctcgtcatggggaagacctccgcggtgccggccgccgtggtgcgc
aactacccttaccaccccggccccgggaccgcgaaagacctcctcatggagcccgagaaa
gacctgttccggtaa

DBGET integrated database retrieval system