KEGG   Rubrobacter xylanophilus: Rxyl_1063Help
Entry
Rxyl_1063         CDS       T00368                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rxyl_1063
Enzymes [BR:rxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rxyl_1063
Exosome [BR:rxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rxyl_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1097762..1099273
Genome map
AA seq 503 aa AA seqDB search
MAGEYVLAIDQGTTGTTVLIFDREGRVAGRAYSEFTQHYPRPGWVEHDPNEIWDVSMRVV
GEALGDAKVSARQLAAIGITNQRETTVMWDRRTGEPVANAIVWQDRRTAGTCDRLKDEGL
EETFRKKTGLVIDAYFSGTKVKWFLDNVAGLRERAGRGEVAFGTVDSWLVYRLTGGRAHI
TDYSNASRTLMYNIYDLRWDEELLEILGVPEGVLPEVKPSSHVYGETDPGAFFQASVPVA
GIAGDQQAALFGQAAYERGLAKNTYGTGSFVLMNTGNEAVPSKEGLLTTIAWGIGEEPVE
YALEGAIFITGAAVQWLRDGLGIIRSAAETEELAKSVQSNDGVYFVPALVGLGAPHWDAY
ARGTIVGITRGTTKAHLARAALESMCYQTLDVVRAMERDSGIELKELRADGGAVANSFLM
QFQSDILGVPVEVPEITETTALGSAYLAGLATGFWESREELDARWRLSRRYEPSMQEGER
ERLHRRWLRAVERSRGWDREEEG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgagtacgtactggccatagaccagggcacgacggggaccacggtcttgatc
ttcgaccgggaggggcgggttgcgggccgggcctactcggagttcacgcagcactacccc
aggccgggctgggtggagcacgacccgaacgagatctgggatgtctccatgcgggtcgtg
ggcgaggcgctgggggacgctaaggtctccgcccggcagctcgccgccatcgggataacc
aaccagcgcgagaccaccgtgatgtgggaccggcgcaccggggagccggtggccaacgcc
atagtctggcaggacaggcgcaccgcgggcacctgcgaccggctcaaggacgaggggctc
gaggagaccttccgcaaaaagacgggtctggtcatagacgcctacttctcgggcaccaag
gtcaagtggtttctggacaacgtcgcgggcctcagggagagggccgggcgcggcgaggtc
gccttcgggaccgtggactcctggctggtgtacaggctcaccggcggccgggcccacatc
accgactactccaacgcctcccggaccctcatgtacaacatctacgacctgcggtgggac
gaggagctcctggagatcctcggggtcccggaaggggtgctcccggaggtcaagcccagc
tcccacgtctacggcgagaccgaccccggggccttcttccaggcctccgtgccggtggcc
ggcatcgcgggcgaccagcaggccgcgctcttcgggcaggccgcctacgagcgggggctc
gccaagaacacctacggcacgggctccttcgtgctgatgaacaccggcaacgaggccgtg
ccgagcaaggagggcctcctcaccaccatcgcctggggcatcggcgaggagcccgtggag
tacgccctcgagggggccatcttcatcaccggggccgccgtgcagtggctgcgggacggt
ctggggatcatccggagcgccgccgagaccgaggagctggccaagagcgtgcagtccaac
gacggggtctacttcgtcccggcgctcgtgggcctgggggcgccgcactgggacgcctac
gcccgcgggacgatcgtcggcatcacccgcggcaccaccaaggcccacctggcgcgcgcg
gccctggagagcatgtgctaccagacgctcgacgtggtgcgcgccatggagcgcgactcc
gggatagagctcaaggagctcagggccgacggcggggccgtggccaactccttcctcatg
cagttccagtcggacatcctcggcgtgccggtggaggtgccggagatcaccgagaccact
gcgctcggctcggcgtacctggccggccttgcgaccggcttctgggagagccgggaggag
ctcgacgccaggtggcggctctcccggcgctacgagccctccatgcaggagggggagcgc
gagcggctgcaccggaggtggctgcgggcggtggagcgctcccggggctgggaccgcgag
gaggagggatga

DBGET integrated database retrieval system