KEGG   Rubrobacter xylanophilus: Rxyl_1102Help
Entry
Rxyl_1102         CDS       T00368                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rxyl_1102
  Amino acid metabolism
   00340 Histidine metabolism
    Rxyl_1102
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rxyl_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1136825..1138081
Genome map
AA seq 418 aa AA seqDB search
MAARLDARGLDAREVVRRLRRPRGFLSREVRAAVRQVVEEVRERGDEALLEYGERFDGVR
PDPLRVPREEIERARAALPGELAEAFRTAIENVRRFHERELDRSWELERGGARLGQRVRP
LRRAGIYVPGGHGAYPSTLVMTAVPAQVAGVEELCVCTPPGPDGRANPRLLAVAGLLGIG
EVYAAGGAQAVAAMAFGTESVPRVDKIVGPGNDYVTAAKLEVFGEVGVDAPQGPSELVVV
ADGSARPERVALDLMAQAEHLSGATSVLLTPSGALASGVEPLLSGRPSEHITLVLVRDLE
QALEISNLYAPEHVHLNCEGAGAALERVEAAGLVAVGDLSPVALSDYAAGPSHALPTGGT
ARWASALGTHDFLTRINHMRFSREALRELGPHVERLARMEGFENHAASVAARREKEEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttggcggctaggctggacgcccgcgggctggatgcccgggaggtggtccggaggctgcgg
cgcccgaggggcttcctctcccgggaggtgcgcgcggcggtccggcaggtggtggaggag
gtccgggagaggggggacgaggccctcctggagtacggcgagcgcttcgacggggtgcgc
ccggaccccctccgggtcccccgggaggagatagagagggcccgcgcggccctgccgggg
gagctcgcggaggccttccggaccgccatagagaacgtccgccgcttccacgagcgggag
ctggaccgctcctgggagctggagcgcggcggagcgcgcctcggccagcgggtgcggccg
ctgcggagggccgggatctacgtccccggcggccacggggcctacccgagcaccctggtc
atgaccgccgtcccggcgcaggtggcgggggtggaggagctgtgcgtctgcaccccgccc
ggccccgacgggcgggcgaacccccggctgctcgcggtggccgggcttctggggatcggg
gaggtctacgcggcgggcggggcccaggcggtggcggcgatggccttcggcaccgagagc
gtcccgcgggtggacaagatcgtgggccccggcaacgactacgtgaccgccgccaagctg
gaggtcttcggcgaggtgggcgtggacgccccccagggcccgagcgagctcgtggttgtc
gccgacggctccgcccgcccggagcgggtggcgcttgacctcatggcccaggccgagcac
ctctccggcgccacctcggtgctcctcaccccgagcggggcgctcgcgagcggcgtggag
cccctgctctccggcaggccctccgagcacataaccctcgtgctggtgcgcgacctggag
caggcgctggagatctccaacctctacgccccggagcacgtgcacctgaactgcgagggg
gccggggcggcgctggagcgggtggaggctgcggggctcgtggccgtcggggacctcagc
cccgtggccctctccgactacgccgccggcccctcccacgccctgcccaccggcgggacc
gcccgctgggcctccgccctcgggacccacgacttcctcacccgcataaaccacatgcgc
ttctcccgggaggcgctccgggagctcgggccgcacgtggagcggctcgcccgcatggag
ggcttcgagaaccacgccgcgagcgtcgcggcgcgcagagagaaggaggaggggtga

DBGET integrated database retrieval system