KEGG   Rubrobacter xylanophilus: Rxyl_1171Help
Entry
Rxyl_1171         CDS       T00368                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00790  Folate biosynthesis
rxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rxyl_1171
Enzymes [BR:rxy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rxyl_1171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABG04137
JGI: Rxyl1171
UniProt: Q1AWU1
Position
1197265..1197861
Genome map
AA seq 198 aa AA seqDB search
MTEAYPPRGRVDRERIQRAVREILVAVGEDPEREGLLGTPRRVAEAYEYLFSGLREDPLR
HLQVGFMEDYRDLIIVRDIYLASLCEHHLLPFIGRAHVAYAPRGKVVGISKLARLVEGYA
RRPQLQERLTSQIADALYEGLGSRGSLVIVEADHSCMTMRGVQKPGSVTVTSASRGIYRE
DGALRSELTDLILRGREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaggcctatcccccgcggggccgggtcgaccgggagaggatccagcgcgcggtg
cgcgagatactggtggccgtcggcgaggatccggagcgggaggggctcctggggaccccg
cggagggtcgccgaggcctacgagtacctcttctccgggctcagggaggacccgctgcgc
caccttcaggtcggcttcatggaggactaccgggacctcatcatcgtccgggacatctac
ctcgcctcgctctgcgagcaccacctgctgccgtttatcgggagggcgcacgtggcctac
gccccgcggggcaaggtggtggggatctccaagctcgcccggctggtggagggctacgcc
cgccggccccagctgcaggagcggctcacctcccagatcgccgacgccctctacgagggg
ctcggctcgcgggggtcgctggtcatcgtcgaggcggaccactcgtgcatgacgatgcgg
ggggtgcagaagcccgggagcgtcaccgtgacctcggcctcccggggcatctaccgggag
gacggggcgctgcgctccgagctcacggacctcatcctgcgcgggcgggagatctga

DBGET integrated database retrieval system