KEGG   Rubrobacter xylanophilus: Rxyl_1185Help
Entry
Rxyl_1185         CDS       T00368                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rxy  Rubrobacter xylanophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1211561..1212205
Genome map
AA seq 214 aa AA seqDB search
MPGSPEDLVRAAAAAGVGDRRVLEALRRVPRELFVPPERAAEAYLDRPVPIPHGQVTTQP
SLVARMVEALGLGGEERVLEIGTGYGFQTALLARLCAFVWSVERHPDVAEAARQNLSRHG
VSNARVVVGDGTRGLPGEAPFDAILVSAAFTRVPEPLARQLAPGGRLVQPVGPGGEEEVV
LFEKGRDGALVRRAGISGARFVRLYGDYGFEPPP
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggctccccggaggatctcgtccgggccgccgcggccgccggggtgggggaccgg
agggtgctggaggcgctgcgccgggtcccccgggagctgttcgtcccgccggagcgcgcc
gcggaggcgtacctggaccgccccgtccccatcccgcacgggcaggtgaccacccagccc
tcgctggtggcgcggatggtggaggccctggggctcgggggcgaagagagggtgctggag
atcgggacgggctacggtttccagacggcgctgctcgcccgcctgtgcgccttcgtgtgg
agcgtcgagcgccacccggacgtggcggaggcggcgcgtcagaacctctcccgccacggc
gtctctaacgcccgcgtggtggtcggcgacggcacgcggggcctccccggagaggccccc
ttcgacgccatcctggtctcggcggccttcacccgggtcccggagcccctggcccggcag
ctcgcccccggcgggcggctggtccagccggtggggccgggcggggaggaggaggtggtg
ctcttcgagaagggccgggacggggcgctggtgcgccgcgccgggatctcgggcgcgcgc
ttcgtgcggctctacggggactacgggttcgagcccccgccctga

DBGET integrated database retrieval system