KEGG   Rubrobacter xylanophilus: Rxyl_1270Help
Entry
Rxyl_1270         CDS       T00368                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rxy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rxy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1293205..1294125
Genome map
AA seq 306 aa AA seqDB search
MPERPPVAILGVPMDLGQDRRGVDMGPSAIRYARLQPALEELGYRVSDLGNVEVPIPEAA
SGGDGKAWRLRAVREVCSAVSRRAREAVARGALPVFLGGDHSISIGTVSGVCAAGRTGVL
WVDAHADFNTPESSPSGNIHGMPLAALTGRGHPDLVGVGGEGASVRPEDAVLVGLRSVDR
EERDLLREAGVRVYTMKDIDAYGVAAVVRRALEHLSGLPRLHLSLDLDVVDPEVAPGVGT
PVRGGLTYREAHLLMELVNEAGGVSSLDVVEVNPILDSRNRTAELAVELVASLMGRQILE
LPRRPL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcgcccgcccgtcgccatcctcggcgtccccatggacctcggccaggaccgc
cggggcgtggacatggggccgagcgccatccgctacgcccggctgcagcccgccctggag
gagctcggctaccgcgtctccgacctcggcaacgtggaggtgcccatccccgaggccgcc
tccggcggggacggcaaggcctggcggctgcgcgccgtgcgggaggtctgctccgcggtg
tcccgccgggcgcgggaggccgtcgcgcggggtgcgctgccggtgttcctcgggggggat
cactccatctccatcgggaccgtgtccggggtctgcgcggcgggccgcaccggggttctc
tgggtggacgcccacgcggacttcaacacccccgagagctccccctccgggaacatccac
gggatgccgctcgccgccctcaccggccgggggcacccggacctcgtcggggtcgggggg
gagggggcgagcgtgcgccccgaggacgcggtgctggtggggctcaggtccgtggaccgg
gaggagagggacctcctgcgggaggccggggtgcgggtgtacacgatgaaggacatcgac
gcctacggcgtggccgccgtggtgcggagggcgctcgagcacctctccgggctgccgcgg
ctgcacctctccctcgacctcgacgtcgtcgaccccgaggtggcgccgggggtgggcacc
ccggtgcgcggcggcctcacctaccgggaggcgcacctgctcatggagctcgtcaacgag
gccgggggggtgagctcgctggacgtggtggaggtcaaccccatcctggacagccgcaac
cggaccgcggagctcgccgtcgagctggtggcgagcctgatggggcgtcagatcctcgag
ctcccccgcaggccgctctag

DBGET integrated database retrieval system