KEGG   Rubrobacter xylanophilus: Rxyl_1323Help
Entry
Rxyl_1323         CDS       T00368                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rxy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1350290..1350880
Genome map
AA seq 196 aa AA seqDB search
MIDRLRGQLVEKDPEGVVVDCGGVGYRAAAPLSTLRALPAVGEECVVHTRMVVREDAMLL
FGFATREEREAFDALTSVSKVGPRLALAVLSAMTPGQMMEAAARGDVHRFAAVPGLGRKT
AERLVLELRGRELAAAGGGGGVAAGEGDGPFMEAREALTGLGYSLEEAERALRDVPPQET
VEQYIKAALRKIGGRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatagacaggcttcgcggacagctggtagagaaggaccccgagggggtggtcgtggat
tgcgggggcgtcgggtaccgcgccgccgccccgctctccacgctcagggcgctgcccgcc
gtgggggaggagtgcgtggtgcacacccggatggtggtgcgcgaggacgccatgctcctc
ttcgggttcgccacccgggaggagcgggaggccttcgacgccctcacctccgtcagcaag
gtcgggccgcggctcgcgctcgcggtgctctcggcgatgacgccggggcagatgatggag
gcggcggcgcggggggacgtgcacaggttcgccgcggtgcccgggctcgggcggaagacc
gccgagcggctggtgctcgagctcaggggacgagagctcgcggcggccggtggcgggggc
ggcgtcgcggccggcgagggggacgggcccttcatggaggcccgcgaggccctcaccggg
ctggggtactccctggaggaggccgagagggcgctccgggacgtgccgccgcaggagacc
gtcgagcagtacatcaaggctgcgctcaggaagatagggggcaggcgctag

DBGET integrated database retrieval system