KEGG   Rubrobacter xylanophilus: Rxyl_1473Help
Entry
Rxyl_1473         CDS       T00368                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00230  Purine metabolism
rxy01100  Metabolic pathways
Module
rxy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rxyl_1473
Enzymes [BR:rxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rxyl_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 MMR_HSR1 AAA_22 AAA_29 ABC_tran T2SSE RsgA_GTPase AAA_30 CPT NTPase_1 Viral_helicase1 AAA_25 AAA_23 Cytidylate_kin AAA_28 cobW Zeta_toxin RNase_PH AAA_27 ATPase_2 TsaE AAA Adeno_IVa2 AAA_21 Rad17
Motif
Other DBs
NCBI-ProteinID: ABG04435
JGI: Rxyl1473
UniProt: Q1AVZ3
Position
complement(1492645..1493220)
Genome map
AA seq 191 aa AA seqDB search
MRRGRLIVVSGPSGAGKSTLIRAALDAVPQLAYSVSATTRAPRPGEVNGRDYIFLSREEF
ERWIREGRFLEWAEYSGNLYGTPAHRVEEYLESGLSVILEIELQGARKVRRKRPDAVMIF
VRAPSLEETRRRLEGRATESEDAVQRRLATAVEEVAARDEFDCEVVNDDYERAREEMIEI
MRRIVAGGDPC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcggggaaggctgatcgtcgtctccggcccctcgggggccgggaagtccaccctc
atccgggcggcgctcgacgccgtaccgcagctcgcctactcggtctccgccaccaccagg
gccccgcgccccggggaggtcaacggccgggactacatcttcctctcgcgggaggagttc
gagcgctggatccgggaggggcgctttctggagtgggccgagtactccggcaacctctac
ggcacccccgcccaccgggtggaggagtacctggagagcgggctctccgtgatcctggag
atagagctgcagggggcccgcaaggtgcgccgcaagcgcccggacgcggtgatgatcttc
gtgcgcgccccctcgctcgaggagacccgccggcggctcgaggggcgggccaccgagagc
gaggacgccgtgcagcggcggctcgccaccgccgtcgaggaggtcgccgcgcgcgacgag
ttcgactgcgaggtcgtcaacgacgactacgagcgggccagagaggagatgatagagata
atgcgcaggatagtcgcaggaggagacccgtgctga

DBGET integrated database retrieval system