KEGG   Rubrobacter xylanophilus: Rxyl_1786Help
Entry
Rxyl_1786         CDS       T00368                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rxy03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1809184..1809981
Genome map
AA seq 265 aa AA seqDB search
MPELPDVEVLKGRLERTSLGRRISRVEVRDGRVVGEVSARGLREALEGRSLRRVHRHGKN
LFAGVEGGGWVLMHFGMAGGLSHLPGTEEEPPHVRLLLGFDGGDRLAFTDRRALGRVHPI
RDPESFVREKGLGPDALRVDYPSFRERLGGRRGAVKSVLMNQGVVAGLGNIYSDEVLFRA
RLHPRTGADRLGEEDIRRLFEATGGVLQTAIDRGADPEALPGSFLLPRRREGARCPRGNG
EIRRLRIAGRTAYYCPACQPGRRES
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcttccggacgtggaggtcttgaagggtcggctggagagaacctcgctgggg
cggcggatctcgcgcgtggaggtgagggacggcagggtagttggggaggtctccgcccgc
gggctgcgggaggccctggagggccgcagcctccggcgcgtccaccgccacggcaagaac
ctcttcgccggcgtcgagggcgggggctgggtgctgatgcacttcggcatggcgggcggc
ctgagccacctgccgggtacggaggaggagccgccgcacgtgaggctgctcctcggcttc
gacggcggggatcgcctcgccttcaccgaccgccgggcgttggggagggtgcatcccatc
cgggacccggagagcttcgtgcgggagaaggggctgggccccgacgcgctccgcgtggac
tacccctccttccgggagcggctcggcgggaggcggggcgcggtgaagtccgtgctgatg
aaccagggcgtcgtcgcggggctggggaacatctactccgacgaggtgctcttccgggcc
cgcctccacccgcggacgggcgcggaccgcctcggggaggaggacatccggcggctcttc
gaggccaccggaggcgtgctgcagaccgccatagaccggggggcggatccggaagcgctt
ccgggctccttcctgctcccccgccggcgcgaaggagcgcgatgcccgcgggggaacggg
gagatccgcagactgcgcatcgccgggcgcaccgcctactactgccccgcgtgccagccc
gggagacgggagagctga

DBGET integrated database retrieval system