KEGG   Rubrobacter xylanophilus: Rxyl_1947Help
Entry
Rxyl_1947         CDS       T00368                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rxyl_1947
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Rxyl_1947
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Rxyl_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1969743..1970582)
Genome map
AA seq 279 aa AA seqDB search
MGVRKNQARLTAAERAAFVRALKVLKAEGIYDMHVSHHRTAVLSMDPDPAHIGPAFFPWH
RECLRRFELDLQKVDPTVTIPYWDFVADGSPSSSIWADDFMGGNGRALDSQVMTGPFAYS
TGEWTLTVNDNRRTPPYLRRAFGVRVSTLPTGTQVNGALRRVTYDAAPWNATVTGSYFRS
FCEKSLHNRVHNWVGGTMLQGSSPNDPVFWMLHCFMDRLWARWRRRYPDSPYLPSSGGPV
GHNLNDPMWPWAAEPDPPTPAKVLDHRQLGYTYDDEASW
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgtgagaaagaaccaggcccggcttaccgccgccgagcgggcggccttcgtccgg
gcgctcaaggtgctcaaggccgagggcatctacgacatgcacgtaagccaccaccggacc
gcggtgctcagcatggaccccgacccggcgcacatcgggccggccttcttcccctggcac
cgggagtgcctgcggcgcttcgagctcgacctgcagaaggtagaccccacggtcaccatc
ccgtattgggacttcgtcgcggacggctccccaagctcctccatctgggccgacgacttc
atggggggcaacgggcgggcgctcgactcccaggtcatgaccgggcccttcgcctactcc
accggcgagtggacgctcaccgtaaacgacaaccgccggacgcccccctacctgcggcgg
gccttcggggtccgggtctccaccctgcccacggggacccaggtcaacggcgccctgcgg
cgggtcacctacgacgcggcgccctggaacgccaccgtgaccggctcctacttccggtcc
ttctgcgagaagtcgctgcacaaccgggtgcacaactgggtgggcgggacgatgctgcag
ggctcgtcccccaacgaccccgtgttctggatgctgcactgcttcatggaccggctgtgg
gcccgctggcgtcggcgctacccggactcgccgtacctgccctcctccgggggaccggtc
gggcacaacctcaacgaccccatgtggccctgggccgcggagcccgacccgccgacccct
gccaaggtgctcgaccacaggcagctcggctacacctacgacgacgaggcgagctggtag

DBGET integrated database retrieval system