KEGG   Rubrobacter xylanophilus: Rxyl_1977Help
Entry
Rxyl_1977         CDS       T00368                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase / uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00860  Porphyrin and chlorophyll metabolism
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01120  Microbial metabolism in diverse environments
Module
rxy_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rxyl_1977
Enzymes [BR:rxy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Rxyl_1977
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rxyl_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase B12-binding
Motif
Other DBs
NCBI-ProteinID: ABG04924
JGI: Rxyl1977
UniProt: Q1AUK4
Position
complement(1997697..1999238)
Genome map
AA seq 513 aa AA seqDB search
MIYLVGSGPGDPGLITAKGLRLLEEADAVVYDRLAPGALLRRARPDAELFYVGKRPGDDQ
AMKQDEINALLVRLGREGRRVVRLKGGDPYVFGRGGEEALALLRAGVPFEVVPGVTSGIA
APAYAGIPVTHRALASSVAFVTGHEDPSKGRTDVDWERVARGADTLVLYMGVGRLGEIAS
SLVAAGRDPATPAAVIRWGTVPEQRTVTGTLADIAQRVAEAGIRPPAVTVVGEVVRLREE
GLAWYEARPLFGRRVVVTRARAQAGELSRRLEELGAAVVEFPTIEIRPPRDFGPLDEAIR
GLDSFDWLVFTSVNGVEAFLERLASHGLDVRAIPRGARIAAIGPATAGRVREAGLRVDVV
PREYRAEALLEEISGEPLRGRRVLIPRAARAREVLPERLREAGAEVSVPPAYETVPSAEG
REELARGLQAGEVDCVTFTASSTVENFVAAFGAREAARLLAGTRVACIGPITAAAARERG
LRVDVEAGEYTIEGLVRAVAGLFAARAPQERVG
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgatctacctggtcggcagcgggccgggcgaccccgggctgatcaccgccaaggggctc
aggctcctcgaggaggccgacgccgtggtctacgaccggctcgcgccgggggcgctgctg
cggcgcgcccggccggacgccgagctcttctacgtcggcaagcggcccggcgacgaccag
gcgatgaagcaggacgagatcaacgcgctgctcgtccggctcggcagggagggcaggcgg
gtggtgcggctcaagggcggcgacccctacgtcttcggccggggcggggaggaggcgctg
gcgctgctccgggccggcgtccccttcgaggtagtgcccggggtgaccagcgggatcgcc
gcccccgcctacgccgggatccccgtgacccaccgcgccctcgcctcgagcgtggccttc
gtcaccggccacgaggacccctccaagggccggacggacgtggactgggagcgggtggcc
cgcggggcggacaccctggtgctgtacatgggggtggggcggctcggcgagatagcctcc
tcgctcgtcgccgccgggcgcgacccggccacccccgcggcggtgatccggtgggggacg
gtccccgagcagcggaccgtcacgggcaccctcgcggacatcgcgcagagggtggcggag
gccgggatacggccgccggcggtgaccgtcgtcggggaggtggtccggctgcgggaggag
gggctcgcctggtacgaggcgcggccgctgttcgggcggcgggtggtggtcacccgggcc
cgggcgcaggcgggggagctctcgcggcggctggaggagctgggcgccgccgtggtggag
ttcccgaccatcgagatacggccccccagggacttcgggccgctggacgaggcgatcagg
ggcctcgactccttcgactggctggtcttcaccagcgtgaacggggtcgaggcgtttctg
gagcggctggcctctcacgggctcgacgtgcgggcgatcccgcggggggccaggatcgcc
gccatcgggcccgccacggcgggccgggtgcgggaggcggggctgcgggtggacgtggtc
ccgagggagtaccgcgccgaggcgctgctggaggagatctcgggggagccgctgcgtggc
aggcgcgtcctgatcccgcgggccgcccgggcgcgggaggtgctccccgagcggctgcgg
gaggccggcgcggaggtctccgtcccgccggcctacgagacggtcccctccgccgagggg
cgggaggagctcgcgcgcgggctccaggccggggaggtggactgcgtgaccttcacggcg
agctccaccgtcgagaacttcgtggcggctttcggcgcgcgggaggccgcccgcctcctg
gccgggacccgggtggcctgcatcggccccataaccgccgccgcggcccgggagcgcggc
ctccgggtagacgtcgaggccggggagtacactatagaggggttggtgagggcggtggcc
gggctcttcgccgcccgcgcgccgcaagagagggtagggtga

DBGET integrated database retrieval system