KEGG   Rubrobacter xylanophilus: Rxyl_2003Help
Entry
Rxyl_2003         CDS       T00368                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rxyl_2003
   01230 Biosynthesis of amino acids
    Rxyl_2003
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_2003
   00051 Fructose and mannose metabolism
    Rxyl_2003
   00562 Inositol phosphate metabolism
    Rxyl_2003
Enzymes [BR:rxy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rxyl_2003
Exosome [BR:rxy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rxyl_2003
  Exosomal proteins of bladder cancer cells
   Rxyl_2003
  Exosomal proteins of melanoma cells
   Rxyl_2003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2024651..2025421)
Genome map
AA seq 256 aa AA seqDB search
MAGERRPLMAANWKMNKTVREAQDYMAALLPRVADLAGEVDVAVFAPFTCLSEVARMAEG
SGVLAGAQNFFYEDSGAYTGEVSAPMLLDVGARASIVGHSERRELFCETDESVARKARRA
VEAGLLPVVCVGETEEERDAGRMWEKVSGQVRAVVEGLGDASGGRVVFAYEPIWAIGTGK
TASPEDAQDAIGRIRGLLRELRGEGFAEEARLLYGGSIKPENISEIMAQKDVDGGLVGGA
SLEVGSFLQLVEAARG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggagaggaggccgctcatggcggccaactggaagatgaacaagaccgtgcgg
gaggcgcaggactacatggccgcgctcctgccgcgggtggccgacctcgccggggaggtg
gacgtggctgtcttcgccccgttcacctgcctctcagaggtcgcccggatggcggagggc
tcgggcgtcctcgccggggcgcagaacttcttctacgaggactcgggggcctacaccggc
gaggtctccgccccgatgctcctggacgtgggggcgcgggcctccatcgtcggccactcg
gagcggcgggagctgttctgcgagaccgacgagtcggtggcgagaaaggcccgccgcgcc
gtggaggccgggctcctgcccgtcgtctgcgtcggggagaccgaggaggagcgcgacgcg
ggccggatgtgggagaaggtctccggtcaggtgcgggcggtggtcgaggggctcggggac
gcctccggggggcgggtggtcttcgcctacgagcccatctgggccataggcaccggaaag
accgcctcccccgaggacgcccaggacgccatcggtcgcatccgggggctgctccgcgag
ctgaggggggaggggttcgccgaggaagcgcgcctcctctacggcggctccataaagccg
gagaacatctccgagatcatggcgcaaaaagacgtcgacggcggcctggtcggcggggcg
agcctggaggtgggctcctttctgcagctcgtcgaggcggcgcgggggtga

DBGET integrated database retrieval system