KEGG   Rubrobacter xylanophilus: Rxyl_2003Help
Entry
Rxyl_2003         CDS       T00368                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rxyl_2003
   01230 Biosynthesis of amino acids
    Rxyl_2003
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_2003
   00051 Fructose and mannose metabolism
    Rxyl_2003
   00562 Inositol phosphate metabolism
    Rxyl_2003
Enzymes [BR:rxy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rxyl_2003
Exosome [BR:rxy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rxyl_2003
  Exosomal proteins of bladder cancer cells
   Rxyl_2003
  Exosomal proteins of melanoma cells
   Rxyl_2003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2024651..2025421)
Genome map
AA seq 256 aa AA seqDB search
MAGERRPLMAANWKMNKTVREAQDYMAALLPRVADLAGEVDVAVFAPFTCLSEVARMAEG
SGVLAGAQNFFYEDSGAYTGEVSAPMLLDVGARASIVGHSERRELFCETDESVARKARRA
VEAGLLPVVCVGETEEERDAGRMWEKVSGQVRAVVEGLGDASGGRVVFAYEPIWAIGTGK
TASPEDAQDAIGRIRGLLRELRGEGFAEEARLLYGGSIKPENISEIMAQKDVDGGLVGGA
SLEVGSFLQLVEAARG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggagaggaggccgctcatggcggccaactggaagatgaacaagaccgtgcgg
gaggcgcaggactacatggccgcgctcctgccgcgggtggccgacctcgccggggaggtg
gacgtggctgtcttcgccccgttcacctgcctctcagaggtcgcccggatggcggagggc
tcgggcgtcctcgccggggcgcagaacttcttctacgaggactcgggggcctacaccggc
gaggtctccgccccgatgctcctggacgtgggggcgcgggcctccatcgtcggccactcg
gagcggcgggagctgttctgcgagaccgacgagtcggtggcgagaaaggcccgccgcgcc
gtggaggccgggctcctgcccgtcgtctgcgtcggggagaccgaggaggagcgcgacgcg
ggccggatgtgggagaaggtctccggtcaggtgcgggcggtggtcgaggggctcggggac
gcctccggggggcgggtggtcttcgcctacgagcccatctgggccataggcaccggaaag
accgcctcccccgaggacgcccaggacgccatcggtcgcatccgggggctgctccgcgag
ctgaggggggaggggttcgccgaggaagcgcgcctcctctacggcggctccataaagccg
gagaacatctccgagatcatggcgcaaaaagacgtcgacggcggcctggtcggcggggcg
agcctggaggtgggctcctttctgcagctcgtcgaggcggcgcgggggtga

DBGET integrated database retrieval system