KEGG   Rubrobacter xylanophilus: Rxyl_2064Help
Entry
Rxyl_2064         CDS       T00368                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rxyl_2064
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rxyl_2064
   00630 Glyoxylate and dicarboxylate metabolism
    Rxyl_2064
Enzymes [BR:rxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rxyl_2064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2094156..2095766)
Genome map
AA seq 536 aa AA seqDB search
MARKRSFPEGVEFTAPIPEEYADVLSPDAVSFVAGLAREFTGRVDEILAARQERQLRINA
GEMPDFPSETREVRESEWRVAPAPPDLQDRRVEITGPPDRKMLINALNSGASTYMTDLED
ANCPTWRNMLESQYNIRDAVRGTITYDDPNTGKHYELGEELATLIVRPRGWHLFEKHMLV
DGRQVPGALFDFGLAFFHNAGRLIENGSGPYYYLPKLEGYREARLWNDVFNMAQDELGIP
RGTIRATVLVETILATFEMDEILYELRDHSSGLNAGRWDYIFSYIKKFREHEDRLLPDRA
QVTMTVPFMRAYTQLLVKVCHRRGAHAIGGMAAQIPVKDDPKKNEEAFAKVRADKEREAR
DGHDGTWVAHPALVPVAKEVFDEYMPQPNQIETKKREDVHVTAEDLLERPEGTITMDGFR
NNISVGIQYLGAWFSGRGAVPVFNLMEDTATAEISRAQVWQWIHHPKAVLDDGTKVTKEL
FHRVMAEEVERIREEIVGPERFRRDRFDTAIEFFDRISTQDEFVEFLTLPGYDYLE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaaagcgttccttccccgagggcgtggagttcaccgctcccatccctgaggag
tatgcggacgtgctctcgcccgacgcggtgagctttgtggccgggctggcccgggagttc
acgggccgggtggacgagattctggcggcgcggcaggagcgtcagctgcggatcaacgcc
ggcgagatgccggacttcccctcggagacgcgggaggtgcgggagtccgagtggcgggtg
gcgccggcgccgcccgacctgcaggaccgcagggtggagatcaccggcccgccggacagg
aagatgctgatcaacgcgctgaactccggggccagcacctacatgaccgacctggaggat
gccaactgccccacctggcggaacatgctggagagccagtacaacatccgggacgcggtg
agggggaccatcacctacgacgaccccaacaccggcaagcactacgagctgggggaggag
ctggccaccctcatcgtccggccgcggggctggcatctcttcgagaagcacatgctggtg
gacggccggcaggtaccgggggccctcttcgacttcgggctggcgttcttccacaacgcg
gggcggctcatcgagaacggcagcggcccctactactacctgcccaagctcgagggctac
cgggaggcccggctctggaacgacgtcttcaacatggcgcaggacgagctcggcatcccg
cgggggaccatcagggccaccgtgctggtggagaccatcctggccaccttcgagatggac
gagatcctctacgagctgcgcgaccactcctcgggcctcaacgccgggcgctgggactac
atcttcagctacataaagaagttccgcgagcacgaggaccggctgctgcccgaccgggcg
caggtgaccatgaccgtgccgttcatgcgcgcctacacccagcttctggtgaaggtctgc
caccggaggggggcgcacgccataggcgggatggccgcccagataccggtcaaggacgac
ccgaagaagaacgaggaggccttcgccaaggtccgcgccgacaaggagcgcgaggcccgc
gacgggcacgacggcacctgggtggcccacccggcgctcgtcccggtcgccaaggaggtc
ttcgacgagtacatgccgcagcccaaccagatcgagaccaaaaagcgcgaggacgtgcac
gtcacggccgaagacctgctggagcgcccggagggcaccatcaccatggacggcttccgc
aacaacatcagcgtgggcatccagtacctcggcgcctggttctccggccgcggcgcggtg
cccgtcttcaacctcatggaggacacggcgaccgccgagatcagccgggcccaggtgtgg
cagtggatccaccaccccaaggccgtcctcgacgacggcaccaaggtcacgaaggagctc
ttccacagggtgatggccgaggaggtcgagaggatccgggaggagatcgtcggccccgag
cgcttccggcgcgaccgcttcgataccgccatcgagttcttcgaccggatctccacccag
gacgagttcgtcgagttcctgaccctgcccggttacgactacctggagtag

DBGET integrated database retrieval system