KEGG   Rubrobacter xylanophilus: Rxyl_2089Help
Entry
Rxyl_2089         CDS       T00368                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rxy  Rubrobacter xylanophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rxyl_2089
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rxyl_2089
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rxyl_2089
Enzymes [BR:rxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rxyl_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2116848..2117639)
Genome map
AA seq 263 aa AA seqDB search
MGGRERLLGAFSKGRPALIPYLTAGYPSLEGAREVARAYLEAGADVLEIGVPFSDPLADG
PTIQDTTARALENGADMDYCLGLAGEFSGRAPVVLLVYYNLIFARGVERFVREAAGAGVS
GVVVPDLPVDEAGEPARAVEKGGMAFCPLAAPTSTDERLEKIGSLASGFVYCVSVAGVTG
VREKLPPGAVELLRRVRARVSAPVALGFGIGSAEAAREAAGEADGIIIGSRLMQLVGEGG
PERAGEWLRGVREALSRTAGRSH
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggtagggagcggctgctcggggccttctcgaaggggcgtccggcgctcatcccc
tacctcaccgccgggtacccctcgctggagggggcgcgggaggtggcccgcgcctacctg
gaggccggggccgacgtgctggagataggggttcccttctccgacccgctcgccgacggc
cctaccatacaggacaccaccgcgcgggcgctcgagaacggcgcggacatggactactgc
ctggggctcgccggggagttctccgggcgggcgccggtggtgctcctcgtgtactacaac
ctgatcttcgcccggggcgtggagcgctttgtccgggaggcggccggggccggggtctcg
ggcgtggtggtgccggatctgcccgtggacgaggccggggagcccgcgcgggccgtcgag
aagggggggatggccttctgcccgctcgccgcccccacctccaccgacgagcgcctggag
aagatcggctccctcgcctctggcttcgtctactgcgtctcggtggccggggtgactggg
gtgcgggagaagctgccccccggggcggtggagctgctgcggcgggtgcgggcgcgggtc
tccgccccggtggcgctgggcttcggcatcggctccgcggaggccgcgcgggaggcggcc
ggggaggccgacggcatcatcatcggcagccggctcatgcagctcgtcggcgagggcggg
ccggagcgggccggggagtggctgaggggggtgcgcgaggcgctctcccggacggcgggg
aggagccattag

DBGET integrated database retrieval system