KEGG   Rubrobacter xylanophilus: Rxyl_2089Help
Entry
Rxyl_2089         CDS       T00368                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00260  Glycine, serine and threonine metabolism
rxy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01130  Biosynthesis of antibiotics
rxy01230  Biosynthesis of amino acids
Module
rxy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rxyl_2089
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rxyl_2089
Enzymes [BR:rxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rxyl_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth DUF3086
Motif
Other DBs
NCBI-ProteinID: ABG05033
JGI: Rxyl2089
UniProt: Q1AU95
Position
complement(2116848..2117639)
Genome map
AA seq 263 aa AA seqDB search
MGGRERLLGAFSKGRPALIPYLTAGYPSLEGAREVARAYLEAGADVLEIGVPFSDPLADG
PTIQDTTARALENGADMDYCLGLAGEFSGRAPVVLLVYYNLIFARGVERFVREAAGAGVS
GVVVPDLPVDEAGEPARAVEKGGMAFCPLAAPTSTDERLEKIGSLASGFVYCVSVAGVTG
VREKLPPGAVELLRRVRARVSAPVALGFGIGSAEAAREAAGEADGIIIGSRLMQLVGEGG
PERAGEWLRGVREALSRTAGRSH
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggtagggagcggctgctcggggccttctcgaaggggcgtccggcgctcatcccc
tacctcaccgccgggtacccctcgctggagggggcgcgggaggtggcccgcgcctacctg
gaggccggggccgacgtgctggagataggggttcccttctccgacccgctcgccgacggc
cctaccatacaggacaccaccgcgcgggcgctcgagaacggcgcggacatggactactgc
ctggggctcgccggggagttctccgggcgggcgccggtggtgctcctcgtgtactacaac
ctgatcttcgcccggggcgtggagcgctttgtccgggaggcggccggggccggggtctcg
ggcgtggtggtgccggatctgcccgtggacgaggccggggagcccgcgcgggccgtcgag
aagggggggatggccttctgcccgctcgccgcccccacctccaccgacgagcgcctggag
aagatcggctccctcgcctctggcttcgtctactgcgtctcggtggccggggtgactggg
gtgcgggagaagctgccccccggggcggtggagctgctgcggcgggtgcgggcgcgggtc
tccgccccggtggcgctgggcttcggcatcggctccgcggaggccgcgcgggaggcggcc
ggggaggccgacggcatcatcatcggcagccggctcatgcagctcgtcggcgagggcggg
ccggagcgggccggggagtggctgaggggggtgcgcgaggcgctctcccggacggcgggg
aggagccattag

DBGET integrated database retrieval system