KEGG   Rubrobacter xylanophilus: Rxyl_2090Help
Entry
Rxyl_2090         CDS       T00368                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00260  Glycine, serine and threonine metabolism
rxy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01130  Biosynthesis of antibiotics
rxy01230  Biosynthesis of amino acids
Module
rxy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rxyl_2090
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rxyl_2090
Enzymes [BR:rxy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rxyl_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABG05034
JGI: Rxyl2090
UniProt: Q1AU94
Position
complement(2117629..2118840)
Genome map
AA seq 403 aa AA seqDB search
MRQRAESGYFGPFGGRYVPETLIHALEELEEAYERYRNDPEFVEELDSLARDFVGRPTPL
MLASRLTRRWGGANVWFKREDLAHTGAHKINNTLGQILLADRMGKRRIIAETGAGQHGVA
TATVAALYGKECVVYMGEEDTRRQRLNVVRMKLLGAEVVPVLSGSRTLKDAVNEAIRDWV
TNVEDTHYIIGSVVGPAPYPRIVRDFQTVIGREIEAQARERFGSDPDAVVACVGAGSNAI
GAFHPFVGREGVRLVGVEAAGRGLASGEHGASLAEGRLGVLHGAKSYVLQTEAGQIREAH
SISAGLDYPATGPEHAYLKDEGLAEYASVTDEEALEGFTLCSRLEGIIPALESAHAIYHA
ERVAKELGPGKNLVVCLSGRGDKDVEVAAAALGVGAEEASGGR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcaaagagctgagagcggctacttcggccccttcgggggccggtacgtgccggag
accctgatccacgcgctcgaggagctagaggaggcctacgagcgctacaggaacgacccg
gagttcgtggaggagctcgactccctggcgcgcgacttcgtcggccgcccgacgccgctc
atgctcgcctcccggctcacccgcaggtggggcggggcgaacgtgtggttcaagcgggag
gatctggcgcacacgggggcgcacaagatcaacaacaccctgggccagatcctgctcgcc
gaccggatggggaagcgccggatcatcgccgagaccggcgcgggccagcacggggtcgcc
acagcgaccgtcgccgccctctacggcaaggagtgcgtcgtgtacatgggcgaggaggac
acgcggcgccagcgcctgaacgtggtgcgcatgaagctcctcggggctgaggtcgtgccc
gtgctctccggctcgcgcacgctcaaggacgctgtgaacgaggcgatacgcgactgggtg
accaacgtggaggacacccactacatcatcgggagcgtggtgggccccgcgccctacccc
aggatcgtgcgcgacttccagacggtcatcgggcgggagatagaggcgcaggcgcgcgag
cgcttcggctcggacccggacgcggtcgtggcctgcgtcggggcgggctcgaacgccatc
ggggccttccacccgttcgtcgggcgcgagggcgtgaggctcgtcggggtggaggccgcc
gggcgggggcttgcgagcggtgagcacggggcctcgctcgcggagggcaggctcggcgtc
ctgcacggggccaagagctacgtgctgcagacggaggcgggccagatccgggaggcgcac
tccatctccgccggcctcgactacccggccaccggcccggagcacgcctacctcaaagac
gaggggctcgccgagtacgccagcgtcaccgacgaggaggcgctggagggcttcaccctc
tgctcgaggctggaggggatcatcccggcgctggagtcggcgcacgccatctaccacgcc
gagagggtggcgaaggagctggggccgggcaagaacctcgtggtctgcctctccgggcgg
ggggacaaggacgtggaggtcgccgccgccgctctgggcgtcggcgcggaggaggcctcc
ggtgggcggtag

DBGET integrated database retrieval system