KEGG   Rubrobacter xylanophilus: Rxyl_2343Help
Entry
Rxyl_2343         CDS       T00368                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00072  Synthesis and degradation of ketone bodies
rxy00650  Butanoate metabolism
rxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Rxyl_2343
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Rxyl_2343
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Rxyl_2343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase NAD_binding_10 TrkA_N KR Methyltransf_11 Methyltransf_25 AdoHcyase_NAD NmrA RmlD_sub_bind THF_DHG_CYH_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABG05271
JGI: Rxyl2343
UniProt: Q1ATK7
Position
complement(2353176..2353964)
Genome map
AA seq 262 aa AA seqDB search
MQVREMPALSGGVVDLDLEGRRAFVTGAASGIGRACAERLARAGASVVVVDLDGEAARAV
AGSIGGEAVQADLSDYAALDALEVEADVVVNNAGLQHVAPVEEFPPEKFSLMLRVMLEAP
FRIVRKALPRMYERGWGRVINISSIHGLIASPYKAAYVAAKHGLEGLSKVIALEGGPKGV
TSNCICPAYVRTPLVENQISDQARTHGIPESEVVEKIMLTEPAIKRLIEPGEVAELVAYL
CSPAASFINGASLTIDGGATAH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagtgagggagatgcctgcgctctccggcggcgtggtggacctcgacctcgagggc
cggagggccttcgtcaccggggccgcgagcggcatcgggcgggcctgcgccgagcgcctc
gcccgggccggcgcctcggtcgtggtggtcgacctcgacggtgaggccgcgcgggcggtc
gccgggagcatcgggggggaggccgtgcaggccgacctctccgactacgccgccctcgac
gcgctggaggtggaggccgacgtggtggtcaacaacgccgggctgcagcacgtggcgccc
gtggaggagttcccgcccgagaagttctccctcatgctccgggtcatgctcgaggcgccc
ttcaggatcgtccgcaaggcgctgccccggatgtacgagcgagggtgggggagggtcatc
aacatctcctccatccacgggctcatcgcctcgccctacaaggcggcctatgttgccgcc
aagcacggcctcgaggggctttccaaggtgatcgcgctcgagggcggcccgaagggggtg
accagcaactgcatctgcccggcctacgtccggacgccgctggtggagaaccagatctcc
gaccaggcccggacccacggcatccccgagagcgaggtcgtagagaagatcatgctcacc
gagcccgccataaagcgcctcatcgagcccggggaggtcgccgagctcgtggcctacctc
tgctcccccgccgcctcgttcataaacggtgcctcgcttacaatagacggcggggctacc
gcccactaa

DBGET integrated database retrieval system