KEGG   Rubrobacter xylanophilus: Rxyl_2405Help
Entry
Rxyl_2405         CDS       T00368                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00010  Glycolysis / Gluconeogenesis
rxy00020  Citrate cycle (TCA cycle)
rxy00620  Pyruvate metabolism
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01120  Microbial metabolism in diverse environments
rxy01130  Biosynthesis of antibiotics
rxy01200  Carbon metabolism
Module
rxy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_2405
   00020 Citrate cycle (TCA cycle)
    Rxyl_2405
   00620 Pyruvate metabolism
    Rxyl_2405
Enzymes [BR:rxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rxyl_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl Abhydrolase_5 Thioesterase Ndr Esterase_phd HlyD_3 Esterase Ser_hydrolase GCV_H Biotin_lipoyl_2 Acyl_transf_1 DUF915 PGAP1
Motif
Other DBs
NCBI-ProteinID: ABG05333
JGI: Rxyl2405
UniProt: Q1ATE5
Position
2416684..2417793
Genome map
AA seq 369 aa AA seqDB search
MSETRQITKLGMPKWGLTMTEGTVVRWLVEEGAELESGDEVVEVESEKINNAVESPAAGV
LRRRVAQEGEVVPVGGLLGVIADPSVPDPEIDAFIEEFRSTFVPEEEEAAGPEPQRTEVG
GRSIQYLAMGEGEPPLVLVHGFGGDINIFVFNQQALASDRAVYALDLPGHGGSSKDVGRG
DLGFFVAVVEGFMDTLGIERAHLAGHSMGGAVAASFALAHPERVASLVLVASAGLGEEIN
GEYIEGFIAANRRREMRDVLGMLFADPELVTRDLVNDVLAYKRLDGVEEALRTVAGSLFP
GGRQARVLDLSGLEVPVLAIWGSEDRIVPAAHAGNLPDAAHVEILEGRGHMVHMEAAGEV
NRLISRFVG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagacccggcagataacgaagctcggcatgcccaagtggggcctcaccatgaca
gaggggacggtcgtgcggtggctcgtcgaggagggggccgagctcgagagcggcgacgag
gtcgtcgaggtcgagagcgagaagataaacaacgccgtggagtcccccgccgcgggcgtg
ctccggcgccgggtggcgcaggaaggcgaggtggtaccggtggggggcctgctcggcgtc
atagccgacccctccgtcccagatccggagatagacgcctttatagaggagtttcgctcc
accttcgtcccggaggaggaagaggccgccggcccggagccgcagaggacggaggtcggc
ggcaggagcatccagtacctcgcgatgggcgagggcgagcctcccctggtgctggtgcac
ggcttcggcggcgacataaacatcttcgtcttcaaccagcaggctctggcctccgaccgc
gccgtctacgccctggacctcccgggccacggcggctcctccaaggacgtggggaggggg
gatctgggcttcttcgtcgcggtggtcgaggggttcatggacaccctcgggatagagcgg
gcccacctggcgggccactccatgggcggcgccgtagccgcgtcgttcgcgctcgcgcac
cccgagagggtcgcctcgctcgtgctagtcgccagcgccgggctcggggaggagatcaac
ggcgagtacatcgagggctttatcgcggccaaccggcgccgcgagatgcgcgacgtgctc
gggatgctcttcgccgacccggagctggtcacccgggacctggtcaacgacgtgctggcg
tacaagcgcctcgacggcgtggaggaggcgctgcggaccgtcgccggcagcctcttcccc
ggggggcgtcaggcgcgggtgctggacctctcgggcctggaggtcccggtgctggcgatc
tggggctcggaggacaggatcgtcccggccgcccacgcggggaacctgcccgacgcagcg
cacgtcgagatcctggagggccgggggcatatggtgcacatggaggccgccggcgaggtg
aaccgcctcatctcccggttcgttggctga

DBGET integrated database retrieval system