KEGG   Rubrobacter xylanophilus: Rxyl_2469Help
Entry
Rxyl_2469         CDS       T00368                                 

Definition
pantothenate synthetase (EC:6.3.2.1)
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rxyl_2469
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rxyl_2469
Enzymes [BR:rxy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase
     Rxyl_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2485305..2486180)
Genome map
AA seq 291 aa AA seqDB search
MSPATLLRSPREVRELSRRWRGEGAVVGLVPTMGALHEGHLSLVRRAWEECGRVIVSVFV
NPTQFGEGEDFERYPRDLEGDRRLLAEAGCDAVFAPAVEDMYGGGTTDLASGERIFVEAG
RLGELWEGEERPGHFRGVCTVVAMLFNAAEPHRAYFGEKDYQQLKVIQKMARDLLFGVEI
VPCPTVREPDGLALSSRNAYLSPQERRAARALWRALEAAAGEARGGVRDARRLERAMEEV
CRAEPLVRLQYAAVVDAETLQRLGELGDRPARALIAARVGETRLIDNAALP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccggcgacgctgctccgaagcccgcgggaggtgcgcgagctctcccggcgctgg
cggggggagggggccgtcgtggggctcgtgcccaccatgggcgcgctgcacgaggggcac
ctctccctcgtgcgccgggcctgggaggagtgcgggcgggtcatcgtctcggtcttcgtc
aaccccacgcagttcggcgagggggaggacttcgagcgctacccccgggacctcgagggc
gaccggcggctgctcgcggaggccggctgcgacgccgtgttcgcccccgcggtcgaggac
atgtacggcggggggaccaccgacctcgcctccggggagcgaatcttcgtggaggccggg
cgtctgggggagctatgggagggggaggagcggcccgggcacttccggggggtgtgcacc
gtggtcgccatgctcttcaacgccgccgagccgcaccgggcgtacttcggggagaaggac
taccagcagctcaaggtcatacagaagatggcgcgcgatctgctgttcggggtggagatc
gtcccctgccccaccgtcagggagccggacgggctcgcgctgagcagccgcaacgcctac
ctctcgccgcaggagcgccgcgcggcccgggcgctgtggcgggcgctggaggcggccgcg
ggagaggcccgcggcggggtgcgcgacgcccgccggctggagcgggcgatggaggaggtc
tgccgggccgagccgctggtgcgtctgcagtacgccgcggtggtggacgccgagacgctg
cagaggctcggggagctgggggaccggccggcccgcgcgctcatcgccgcccgcgtgggc
gagacccgcctcatagacaacgccgcgcttccgtga

DBGET integrated database retrieval system