KEGG   Rubrobacter xylanophilus: Rxyl_2469Help
Entry
Rxyl_2469         CDS       T00368                                 

Definition
pantothenate synthetase (EC:6.3.2.1)
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:rxy00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:rxy00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2485305..2486180)
Genome map
AA seq 291 aa AA seqDB search
MSPATLLRSPREVRELSRRWRGEGAVVGLVPTMGALHEGHLSLVRRAWEECGRVIVSVFV
NPTQFGEGEDFERYPRDLEGDRRLLAEAGCDAVFAPAVEDMYGGGTTDLASGERIFVEAG
RLGELWEGEERPGHFRGVCTVVAMLFNAAEPHRAYFGEKDYQQLKVIQKMARDLLFGVEI
VPCPTVREPDGLALSSRNAYLSPQERRAARALWRALEAAAGEARGGVRDARRLERAMEEV
CRAEPLVRLQYAAVVDAETLQRLGELGDRPARALIAARVGETRLIDNAALP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccggcgacgctgctccgaagcccgcgggaggtgcgcgagctctcccggcgctgg
cggggggagggggccgtcgtggggctcgtgcccaccatgggcgcgctgcacgaggggcac
ctctccctcgtgcgccgggcctgggaggagtgcgggcgggtcatcgtctcggtcttcgtc
aaccccacgcagttcggcgagggggaggacttcgagcgctacccccgggacctcgagggc
gaccggcggctgctcgcggaggccggctgcgacgccgtgttcgcccccgcggtcgaggac
atgtacggcggggggaccaccgacctcgcctccggggagcgaatcttcgtggaggccggg
cgtctgggggagctatgggagggggaggagcggcccgggcacttccggggggtgtgcacc
gtggtcgccatgctcttcaacgccgccgagccgcaccgggcgtacttcggggagaaggac
taccagcagctcaaggtcatacagaagatggcgcgcgatctgctgttcggggtggagatc
gtcccctgccccaccgtcagggagccggacgggctcgcgctgagcagccgcaacgcctac
ctctcgccgcaggagcgccgcgcggcccgggcgctgtggcgggcgctggaggcggccgcg
ggagaggcccgcggcggggtgcgcgacgcccgccggctggagcgggcgatggaggaggtc
tgccgggccgagccgctggtgcgtctgcagtacgccgcggtggtggacgccgagacgctg
cagaggctcggggagctgggggaccggccggcccgcgcgctcatcgccgcccgcgtgggc
gagacccgcctcatagacaacgccgcgcttccgtga

DBGET integrated database retrieval system